Vesugen—also written Vezugen and standardized here as KED for its sequence Lys–Glu–Asp—is a synthetic tripeptide “bioregulator” studied for vascular endothelium and neuroplasticity outcomes in preclinical models. It appears to act via epigenetic regulation of gene expression (DNA/histone interactions) with downstream effects reported for endothelin‑1 (EDN1), connexins (e.g., GJA1/Cx43), and SIRT1 in vascular cells, and markers of neurogenesis/synaptic plasticity in neuronal models. (Khavinson)

Fast Answer / Executive Summary (40–60 words)

Vesugen (KED) is a research‑only tripeptide (Lys–Glu–Asp) investigated as a vascular and neuroprotective “bioregulator.” Early work suggests KED can normalize endothelin‑1, restore connexins, and increase SIRT1 in endothelial cells, and support dendritic structure/neurogenesis markers in neuronal models—likely via short‑peptide interactions with DNA/histones that modulate gene expression. Human evidence remains limited. (PubMed)

Entity Properties (for researchers)

Property Details
Aliases / Synonyms Vesugen, Vezugen (transliteration), KED, Lys–Glu–Asp; lysyl‑glutamyl‑aspartic acid
Family / Pathway Short tripeptide “bioregulator”; vascular endothelium focus; epigenetic gene regulation via DNA/histone interactions; reported effects on EDN1, GJA1/Cx43, SIRT1, MKI67 (Ki‑67) promoter docking. (PubMed)
Sequence (AA) H‑Lys‑Glu‑Asp‑OH (K‑E‑D)
Molecular Weight (Da) ~390.39 (calculated average mass from residue masses + H₂O). (Vanderbilt University)
Molecular Formula C₁₅H₂₆N₄O₈ (PubChem entry: lysyl‑glutamyl‑aspartic acid). (PubChem)
CAS Not assigned (no widely recognized CAS for KED as of Oct 2025); PubChem CID: 87571363. (PubChem)
Typical Diluent(s) Sterile Water for Injection (SWFI); Bacteriostatic Water for Injection (BWFI) is sterile water with 0.9% benzyl alcohol for multi‑dose vial reconstitution (research settings). (DailyMed)
Example Concentrations (educational) 1–2 mg/mL in aqueous media (research laboratory preparation; adjust to assay). See stability/handling notes below. (General peptide stability evidence summarized in peer‑reviewed pharmaceutical literature.) (PMC)
Storage (lyophilized / after reconstitution) Lyophilized peptides are generally most stable at low temperature (≤ −20 °C) away from light/moisture; reconstituted solutions are less stable and typically stored cold for short periods—follow your lab’s validated stability program. (PMC)

Compliance note: This article is educational for researchers, not medical advice. No human use is endorsed or implied.

Core Concepts & Key Entities

What is Vesugen (KED) in simple terms?

Vesugen is a short, three‑amino‑acid peptide (Lys–Glu–Asp) studied as a tissue‑specific “bioregulator” for vascular endothelium and brain. It belongs to a family of ultrashort peptides investigated for epigenetic control of gene expression—by binding to DNA promoter motifs and/or histone proteins—to influence cell‑type‑specific functions. (Khavinson)

How might KED work mechanistically?

KED’s proposed mechanism is epigenetic modulation of gene transcription via direct interactions with DNA and nucleosomal histones, a behavior repeatedly documented for ultrashort peptides in vitro, in silico, and by biophysical methods. In endothelial models, KED normalized EDN1, restored connexins (e.g., Cx37/Cx40/Cx43), and increased SIRT1—changes tied to vasoprotective phenotypes. (MDPI)

A frequently cited table of peptide–DNA complementarity lists “Vesugen (KED) → GCCG” as a presumptive binding sequence in promoter regions, supporting the concept of sequence‑selective DNA interactions by tripeptides. (Khavinson)

What outcomes have been reported in vascular research?

In endothelial and vascular injury contexts, KED showed gene‑level changes consistent with improved microvascular homeostasis. Preclinical studies report EDN1 normalization, connexin re‑expression, and SIRT1 increases, which together suggest improved endothelial communication and anti‑senescence signaling. More independent replication is warranted. (PubMed)

What outcomes have been reported in neuronal/neuroplasticity research?

In Alzheimer’s disease (AD) models, KED preserved dendritic spines and improved dendritic tree metrics in vitro and in the 5xFAD mouse model, while modulating expression of neurogenesis and cell‑cycle genes (e.g., NES, GAP43, p16/p21). A 2024 study in induced neurons from older donors reported enhanced dendritic complexity with KED, with authors positing histone/nucleosome interactions as a likely regulatory route. (MDPI)

A succinct review on KED in AD‑related neurogenesis also notes regulation of SUMO1, APOE, and IGF1, aligning with broader literature on short‑peptide gene regulation. (PubMed)

What about clinical evidence?

Evidence in humans is limited and heterogeneous. A small Russian geriatric study suggested oral Pinealon + Vesugen improved cognitive/functional measures in workers exposed to harmful conditions, and a separate clinical report recommended these peptides as “geroprotectors.” These findings require larger, controlled replication and are not regulatory‑approved indications. (SpringerLink)

Step‑by‑Step / How‑To (Research Handling & Documentation)

Education‑only. Follow your institution’s SOPs, validated methods, and biosafety rules. The points below summarize common research practices supported by pharmaceutical stability guidance.

1) Plan your experiment and documentation

Define the assay (e.g., endothelial gene expression, neuronal morphology), pre‑register methods, and specify endpoints (e.g., EDN1 mRNA, Cx43 protein, dendritic length). Record lot numbers, storage conditions, and timelines to enable reproducibility. (General principles; see stability rationale below.) (PMC)

2) Confirm identity & properties

Log sequence (K‑E‑D), calculated MW (~390.39 Da), and reference PubChem CID 87571363 for chemical metadata in your ELN/LIMS to reduce ambiguity across suppliers. (Vanderbilt University)

3) Choose an appropriate diluent

For single‑use aliquots, Sterile Water for Injection is typical. For multi‑withdrawal research vials, BWFI (sterile water with 0.9% benzyl alcohol) is commonly used; note preservative cautions in neonatal/clinical contexts (relevant to safety training, not to endorse human use). (DailyMed)

4) Reconstitute under aseptic conditions

Warm the sealed vial to ambient before opening (to limit condensation), then reconstitute to a validated working concentration (e.g., 1–2 mg/mL) using sterile technique. Mix gently; avoid foaming. Document pH/vehicle and filter‑sterilize only if your method requires it. (Peptide stability guidance summarized below.) (PMC)

5) Aliquot and label immediately

Prepare single‑use aliquots to minimize freeze‑thaw. Label with peptide ID, lot, concentration, diluent, and expiry per your lab’s stability protocol. (Journal of Pharmaceutical Sciences)

6) Store appropriately (lyophilized vs. solution)

  • Lyophilized: Store desiccated, light‑protected, preferably ≤ −20 °C, per your QA plan.
  • In solution: Expect shorter stability; keep cold and adhere to pre‑set retest intervals. Use lyoprotectants if formulating and validate with forced‑degradation data when applicable. (PMC)

7) Thawing & handling

Thaw on ice or at 2–8 °C, swirl gently, and avoid repeated freeze–thaw. Discard if turbidity/precipitation or pH drift occurs beyond your acceptance criteria. (Royal Society Publishing)

Comparison / Alternatives (Where Does KED Fit?)

Answer in one line: KED (Vesugen) is vascular‑centric with cross‑over neuroplasticity signals, whereas EDR (Pinealon) and AEDG (Epitalon) are often positioned as neuro‑centric and genome/aging‑centric, respectively; all three are short peptides investigated for epigenetic regulation. (MDPI)

Important: These are research‑only peptides; comparative notes below summarize preclinical literature (not therapeutic recommendations).

Feature Vesugen (KED) Pinealon (EDR) Epitalon (AEDG)
Sequence / Type Lys–Glu–Asp (tripeptide) Glu–Asp–Arg (tripeptide) Ala–Glu–Asp–Gly (tetrapeptide)
Primary research focus Vascular endothelium; vasoprotective gene shifts; also neuroplasticity in AD models Neuroprotection/neurogenesis; dendritic spines; oxidative stress responses Chromatin/telomerase and wide gene‑regulatory effects in aging models
Mechanistic highlights DNA/histone interactions; EDN1 normalization, connexin restoration, SIRT1↑ DNA/histone interactions; preserves dendritic spines; supports dendritogenesis DNA binding; telomerase gene activation; chromatin decondensation in aging cells
Representative models Endothelial cultures; vascular injury/atherosclerosis; 5xFAD mice (neuro) Neuronal cultures; 5xFAD mice; induced neurons from aged donors Human fibroblasts; diverse cell lines; animal models
Selected gene markers EDN1, GJA1/Cx43, SIRT1; MKI67 promoter docking p16/p21, NES, GAP43; AD‑linked genes TERT/telomerase; broad genomic programs
Evidence type In vitro/in vivo (preclinical); mechanistic reviews In vitro/in vivo (preclinical); mechanistic reviews In vitro/in vivo; mechanistic and biophysical studies

Citations: KED vascular & SIRT1/connexins/EDN1; docking to MKI67 (Ki‑67) promoter; KED/EDR neuroplasticity; EDR/AEDG histone/DNA interactions; AEDG telomerase/chromatin. (PubMed)

Templates / Checklist / Example

Copy‑Ready Lab Checklist (KED Research Use Only)

  • Define objective: State your primary endpoint (e.g., EDN1 mRNA, Cx43, dendritic length).
  • Standardize identity: Record sequence (K‑E‑D), MW (~390.39 Da), PubChem CID 87571363. (Vanderbilt University)
  • Select diluent: SWFI for single‑use; BWFI (0.9% benzyl alcohol) for multi‑withdrawal research vials; document choice/rationale. (DailyMed)
  • Plan concentration: Pre‑specify a working concentration (e.g., 1–2 mg/mL) and assay volumes; validate solvent compatibility. (PMC)
  • Aseptic reconstitution: Warm vial to room temp before opening; reconstitute; mix gently; avoid foaming. (Royal Society Publishing)
  • Aliquot & label: Create single‑use aliquots; label with ID/lot/diluent/concentration/expiry per SOP. (Journal of Pharmaceutical Sciences)
  • Storage plan: Lyophilized ≤ −20 °C, desiccated, light‑protected; solutions short‑term cold; define retest intervals. (PMC)
  • Thawing SOP: Thaw on ice/2–8 °C; avoid repeat freeze–thaw. (Royal Society Publishing)
  • Assay controls: Include vehicle control, unrelated tripeptide control, and positive control if applicable.
  • Report metadata: Lot, supplier, certificate of analysis snapshot, storage log, deviations, and raw data links.

FAQs (NLP‑Friendly, Answer‑First)

1) What is Vesugen (KED)?
Vesugen is a synthetic tripeptide (Lys–Glu–Asp) studied as a vascular and neuroprotective bioregulator that appears to modulate gene expression via DNA/histone interactions. Preclinical reports include normalization of endothelin‑1, restoration of connexins, and SIRT1 increases in endothelium, and dendritic support in neuronal models. (Khavinson)

2) How does KED influence gene expression?
KED influences gene expression through short‑peptide interactions with DNA and histones, a mechanism shown across ultrashort peptides, with KED specifically noted for potential histone/nucleosome binding and promoter docking (e.g., MKI67). This epigenetic route aligns with observed changes in endothelial and neuronal markers. (MDPI)

3) What outcomes are reported for vascular research?
Reported vascular outcomes include EDN1 normalization, connexin restoration, and increased SIRT1, consistent with improved endothelial communication and anti‑senescence signals in preclinical models of atherosclerosis/restenosis. These data are promising but require independent replication. (PubMed)

4) What outcomes are reported for brain/neuroplasticity research?
KED preserved dendritic spines and enhanced dendritic arborization in 5xFAD mice and neuronal cultures; gene markers for neurogenesis (e.g., NES, GAP43) and cell cycle (p16/p21) were modulated. Induced neurons from older donors showed improved dendritic metrics with KED exposure. (MDPI)

5) Is there clinical evidence for KED?
Human evidence is limited. A small Russian study recommended Pinealon and Vesugen as geroprotectors in geriatric practice, and a separate report described cognitive/functional improvements with combined use under specific conditions, but robust randomized trials are lacking and no mainstream regulatory approvals exist. (PubMed)

6) How should KED be stored and handled in the lab?
Store lyophilized peptide desiccated and cold (≤ −20 °C) and keep solutions cold and short‑lived per your SOP; avoid repeated freeze–thaw. Use BWFI (0.9% benzyl alcohol) for multi‑withdrawal research vials when appropriate. Validate stability with your own data. (PMC)

Evidence Highlights (Information Gain)

To help researchers map KED’s literature to outcomes of interest, below is a concise mechanism‑to‑marker mapping drawn from peer‑reviewed papers:

  • Vascular Homeostasis → EDN1, connexins (Cx37/Cx40/Cx43), SIRT1 shifts in endothelial models; potential benefit in atherosclerosis/restenosis contexts. Implication: microvascular tone/communication support. (PubMed)
  • Cell Proliferation → MKI67 promoter docking and Ki‑67 changes in endothelial/aging models. Implication: controlled proliferation under aging stressors. (PubMed)
  • Neuroplasticity → Dendritic spine preservation, dendritic arborization increases; regulation of NES, GAP43, p16/p21, and AD‑linked genes; likely histone interaction. Implication: structural substrates for plasticity. (MDPI)
  • Genome Engagement → DNA binding sequence GCCG listed for KED; short peptides can destabilize/reshape DNA locally and bind histone tails. Implication: sequence‑selective transcription cues. (Khavinson)

Stability/Handling Rationale: Pharmaceutical literature shows lyophilization + low temperature and, where applicable, lyoprotectants support peptide integrity; solutions are less stable and require stringent time/temperature control and aliquoting. Implication: plan your KED workflows to minimize hydrolysis/oxidation and aggregation. (PMC)

Next Steps

If you’re exploring vascular signaling, endothelial senescence, or dendritic morphology in aging/AD models, KED offers a compact, mechanistically rich probe to test epigenetic control → phenotype hypotheses alongside appropriate controls.

Bottom line: Vesugen (KED) is a small, epigenetically active research peptide with vascular and neuronal readouts worth testing in well‑controlled models—human claims remain preliminary and require rigorous trials. (PubMed)

PNC‑27 (also written PNC27 or PNC 27) is a 32–amino acid chimeric peptide that fuses the p53 transactivation segment (residues 12–26) to a cell‑penetrating leader. In tumor models, it binds membrane HDM2/MDM2, assembles transmembrane pores, and causes rapid necrosis while largely sparing normal cells. After this brief standardization, this article uses PNC‑27 consistently. (PMC)

Fast Answer / Executive Summary (40–60 words)

PNC‑27 is a research‑only anticancer peptide that targets membrane‑localized HDM2 (also called MDM2) on some tumor cells, forms pore‑like complexes, and triggers necrotic death in preclinical models. It is not FDA‑approved, lacks published human efficacy trials, and has drawn regulatory warnings about unapproved patient use. Reserve it strictly for laboratory research. (PMC)

Entity Properties (for researchers)

Property Details
Aliases / Synonyms PNC‑27; p53(12–26)–penetratin/MRP chimera; HDM2‑targeted lytic peptide
Family / Pathway Membrane‑active oncolytic peptide; interacts with HDM2/MDM2 (p53 negative regulator); induces necrotic death via pore formation
Sequence (AA) PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (32 aa)
Molecular Weight (Da) ~4031 (from sequence)
CAS Not assigned (research peptide)
Typical Diluent(s) Aqueous buffers (e.g., sterile water, PBS); validate solubility and compatibility for your assay
Example Concentration(s) (educational) Reported in vitro ranges ~10–100 µg/mL (≈2.5–25 µM) with time‑dependent LDH release/necrosis; optimize empirically per model
Storage Lyophilized at ≤ –20 °C (preferably colder), desiccated, protected from light; after reconstitution, aliquot and refrigerate/freeze to avoid repeated freeze–thaw

Notes & sources: The sequence/size are reported in peer‑reviewed literature and databases; concentration bands reflect doses used across leukemia and solid‑tumor cell models; storage practices follow peer‑reviewed/consensus guidance for peptides/lyophilized biologics. (PMC)

Core Concepts & Key Entities

What is PNC‑27—and how does it work?

PNC‑27 is a 32‑residue chimeric peptide that binds HDM2/MDM2 in tumor‑cell membranes and forms transmembrane pores that precipitate necrotic cell death. The p53(12–26) segment confers HDM2 binding, while the leader sequence supports membrane engagement. Electron microscopy, co‑localization, and LDH‑release assays demonstrate pore‑associated necrosis in cancer cells but not in matched normal cells under identical conditions. (PMC)

Why target HDM2/MDM2 at the membrane?

HDM2/MDM2 is best known as an intracellular E3 ligase that suppresses p53. Several groups report aberrant HDM2 at the tumor plasma membrane, enabling extracellular targeting. PNC‑27 leverages this to bind membrane HDM2, co‑localize at the surface, and assemble pore‑like structures visualized by immuno‑EM—a mechanism independent of p53 status. (PMC)

What does the experimental evidence show?

  • Broad in‑vitro cytotoxicity with selectivity claims: PNC‑27 kills diverse tumor cell lines (e.g., pancreatic, melanoma, breast, ovarian, leukemia) while sparing normal cells in the same assays; pores lined by PNC‑27–HDM2 complexes have been reported by immuno‑SEM and related imaging. (Annals of Clinical Laboratory Science)
  • p53‑independent activity: PNC‑27 efficiently lyses K562 leukemia cells, which are p53‑null, supporting membrane‑targeted rather than nuclear p53‑dependent activity. (PubMed)
  • Leukemia models: In U937, OCI‑AML3, HL‑60 and other leukemia lines, PNC‑27 co‑localizes with membrane HDM2, triggers LDH release within hours, and reduces colony formation; normal hematopoietic cells are comparatively resistant under matched conditions. (PubMed)
  • Patient‑derived ovarian cancer (ex vivo): Primary epithelial ovarian cancer cultures (including chemoresistant subsets) showed selective cytotoxicity to PNC‑27; this has been cited in oncology reviews discussing peptide strategies for ovarian tumors. (PubMed)
  • Mechanistic updates (2024): Antibody‑blocking/epitope mapping indicates PNC‑27 binds the p53 site on HDM2 (residues 1–109); mitochondrial disruption appears downstream of membrane pore formation. (PubMed)

Key takeaway: PNC‑27 consistently shows HDM2‑dependent, membrane‑pore formation and necrotic killing of tumor cells in preclinical models—with relative sparing of normal cells—independent of tumor p53 status. (PMC)

What are the limitations and safety signals?

  • Regulatory status: No FDA approval or authorization exists for PNC‑27. In 2017, the FDA warned cancer patients not to use PNC‑27 products, citing contamination (e.g., Ralstonia insidiosa) in an inhalation sample and the lack of established safety/efficacy. Any use must remain laboratory‑only. (U.S. Food and Drug Administration)
  • Human data: No randomized or prospective human efficacy trials have been published. A 2017 case report described massive gastrointestinal hemorrhage after experimental PNC‑27 administration abroad; causality is uncertain but underscores risk and the need for ethical oversight. (Lippincott Journals)
  • Reproducibility/independence: A substantial portion of the literature comes from a limited set of laboratories; broader, independent replications with standardized protocols are essential. (See citations throughout.)
  • Generalizability: Activity appears to correlate with membrane HDM2; tumor types without this feature may be insensitive. (PubMed)

Step‑by‑Step / How‑To (Educational): Designing a Rigorous PNC‑27 In‑Vitro Study

Goal: Determine whether membrane HDM2–dependent pore formation explains PNC‑27 response in your model—while quantifying selectivity vs. normal cells.

1) Select biologically justified models

Choose tumor lines with evidence of membrane HDM2 (literature or your own screening). Include matched normal cell counterparts and at least one p53‑null tumor line (e.g., K562) to test p53‑independence directly. (PubMed)

2) Verify target exposure: surface HDM2

Confirm plasma‑membrane HDM2 by flow cytometry/surface immunostaining prior to dosing. In leukemia models and solid tumors, PNC‑27 response tracks with membrane HDM2 presence. (PubMed)

3) Prepare peptide stocks with stability in mind

Reconstitute in compatible aqueous buffer (e.g., sterile water or PBS) appropriate to your assay; prepare single‑use aliquots; store cold and avoid repeated freeze–thaw to preserve integrity—best practices documented in Clinical Chemistry (CPTAC consensus) and lyophilized product stability literature. (PubMed)

4) Design dose–response and time course

Anchor initial ranges to peer‑reviewed reports: ~10–100 µg/mL (≈2.5–25 µM) with sampling at 0.5–24 h to capture LDH release and rapid necrosis. Calibrate around EC50 and time‑to‑lysis for your specific lines. (PubMed)

5) Run the right controls

Include: vehicle, negative‑control peptide (e.g., PNC‑29), and mechanism comparators (e.g., nutlin as an intracellular HDM2 inhibitor) to contrast with membrane‑pore activity. Use isotype or anti‑HDM2 blocking to test target dependence. (MDPI)

6) Measure orthogonal outcomes

Primary: LDH release (necrosis) and viability assays (MTT/CellTiter). Secondary: co‑localization imaging of PNC‑27 + HDM2 at the membrane and, where feasible, immuno‑EM for pore structures. (Annals of Clinical Laboratory Science)

7) Quantify selectivity

Apply the same protocol to normal cells. Report tumor‑to‑normal kill ratios and HDM2 surface levels to contextualize selectivity claims for your system. (PubMed)

8) Explore downstream effects (optional)

Track mitochondrial integrity (e.g., Mitotracker retention) and other organellar changes reported downstream of pore formation in recent mechanistic work. (PubMed)

9) Document and pre‑register internally

Given active debate and translational interest, transparent, reproducible methods (including negative results) add field value.

Information‑gain framework: HDM2‑Gate → Pore‑Proof → Selectivity‑Score
HDM2‑Gate: Only proceed when surface HDM2 is verified.
Pore‑Proof: Pair LDH↑ with co‑localization/pore imaging.
Selectivity‑Score: Quantify tumor vs. normal kill and relate to HDM2 levels. (PubMed)

Comparison / Alternatives (“X vs Y” context)

Where does PNC‑27 sit among membrane‑active/peptide oncology approaches?

Peptide Core Mechanism Primary Target/Context Selectivity Claim (models) Clinical Status (Oct 2025) Notes & sources
PNC‑27 Binds membrane HDM2/MDM2 → pore formation → necrosis Tumor cells with surface HDM2 Spares normal cells lacking membrane HDM2 No human efficacy trials; not FDA‑approved Multiple in‑vitro/ex‑vivo studies; antibody blocking and pore visualization; regulatory warning for patient use (2017). (PMC)
LTX‑315 Cationic membranolytic oncolytic peptide → immunogenic cell death Negatively charged tumor membranes; TME remodeling Tumor‑selective membranolysis with T‑cell infiltration Phase I monotherapy/combination data; ongoing exploration Converts “cold” to “hot” tumors; clinical signals with checkpoint blockade. (AACR Journals)
p28 (azurin‑derived) Enters cancer cells; stabilizes/activates p53 (non‑HDM2 route) → apoptosis/cell‑cycle effects Intracellular p53 interface Cancer‑preferential uptake Two Phase I trials (adult & pediatric) Distinct, non‑lytic mechanism; useful comparator for p53‑modulating peptides. (PMC)

This context emphasizes that PNC‑27 remains preclinical, whereas LTX‑315 and p28 have Phase I human data (safety, pharmacodynamics), though neither is broadly approved for cancer treatment. (AACR Journals)

Templates / Checklist / Example

Research‑Readiness Checklist for PNC‑27 (copy‑ready)

  • Define scope: Restrict all work to laboratory research; no human use; document FDA warning and non‑approval status. (U.S. Food and Drug Administration)
  • Choose models smartly: Select HDM2‑positive tumor lines plus matched normal cells to test selectivity. (PubMed)
  • Verify target exposure: Confirm surface HDM2 by flow cytometry/surface staining before dosing. (PubMed)
  • Prepare stocks carefully: Use compatible aqueous buffers; aliquot; store cold; avoid freeze–thaw per CPTAC/lyophilized stability guidance. (PubMed)
  • Plan dosing/time: Start around 10–100 µg/mL (≈2.5–25 µM) with 0.5–24 h time points; refine to model‑specific kinetics. (PubMed)
  • Include proper controls: PNC‑29 (negative), vehicle, anti‑HDM2 blocking, and an intracellular HDM2 inhibitor (e.g., nutlin) as a mechanistic contrast. (MDPI)
  • Capture mechanism: Pair LDH release with HDM2/PNC‑27 co‑localization; add immuno‑EM for pore visualization when feasible. (Annals of Clinical Laboratory Science)
  • Quantify selectivity: Report tumor‑to‑normal kill ratios and correlate with HDM2 surface levels. (PubMed)
  • Report with transparency: Archive raw data and negative findings; note any off‑target cytotoxicity.

FAQs (NLP‑friendly, answer‑first)

What is PNC‑27?
PNC‑27 is a 32‑amino‑acid peptide that fuses the p53(12–26) segment to a cell‑penetrating leader and binds HDM2/MDM2 at tumor‑cell membranes to form pores, causing necrotic death in models. It is for research use only. (PMC)

How does PNC‑27 kill cancer cells?
PNC‑27 kills cancer cells by co‑localizing with membrane HDM2 and assembling transmembrane pores, which rapidly compromise membrane integrity (LDH release) and can precede mitochondrial disruption; the effect is p53‑independent. (PMC)

Is PNC‑27 FDA‑approved?
No. PNC‑27 is not FDA‑approved for any indication. In 2017 the FDA warned patients not to use PNC‑27 products marketed for cancer treatment due to contamination findings and lack of evidence. Use is restricted to controlled laboratory research. (U.S. Food and Drug Administration)

Are there human clinical trials showing PNC‑27 works?
There are no published randomized or prospective human efficacy trials of PNC‑27. A case report described massive GI hemorrhage after experimental treatment administered outside the U.S., emphasizing risk and the need for rigorous oversight. (Lippincott Journals)

Does PNC‑27 require functional p53 in tumor cells?
No—PNC‑27’s mechanism is p53‑independent because it acts at the cell membrane via HDM2. For example, p53‑null K562 leukemia cells are killed by PNC‑27 in vitro. (PubMed)

What concentrations and exposure times are typical in vitro?
Published studies often test ~10–100 µg/mL (≈2.5–25 µM) with minutes‑to‑hours exposures that produce LDH release and necrosis in responsive tumor lines; always optimize empirically for your model and assay endpoints. (PubMed)

How should researchers store and handle PNC‑27?
Store lyophilized peptide at ≤ –20 °C (preferably colder), protected from light and moisture; after reconstitution, aliquot and avoid repeated freeze–thaw. These practices follow CPTAC consensus and lyophilized drug‑product guidance. (PubMed)

Next Steps

If you’re evaluating membrane‑targeted lytic strategies in vitro, PNC‑27 offers a mechanistically distinct probe: confirm surface HDM2, visualize pore formation, and quantify necrotic kinetics. For an educational protocol overview, see: PNC‑27 30 mg Vial: Dosage Protocol (educational). For research‑grade PNC‑27 (no human use), see PureLabPeptides: PNC‑27 30 mg.

Bottom line: PNC‑27 is a research‑only peptide with a compelling membrane‑HDM2 pore‑formation mechanism and selective tumor cytotoxicity in models—but without human efficacy data and under explicit FDA warnings. Design target‑verified, control‑rich experiments before inferring translational potential. (PMC)

Vilon (also seen as “KE,” Lys‑Glu, or lysyl‑glutamic acid) is a two–amino‑acid peptide studied as a thymic bioregulator that modulates immune signaling and age‑related gene expression. Peer‑reviewed work shows Vilon (L‑Lys‑L‑Glu) can increase interleukin‑2 (IL‑2) gene expression in lymphocytes, remodel chromatin in aged cells, and extend lifespan in mice, with favorable safety in preclinical models. (PubMed)

Fast Answer: Vilon is a synthetic dipeptide (Lys‑Glu) from the thymic peptide bioregulator family studied for immune modulation and cellular “rejuvenation” effects. In vitro and animal studies report IL‑2 gene upregulation, chromatin decondensation in aged lymphocytes, and lifespan extension in mice, suggesting a role in restoring immune balance and transcriptional programs associated with healthy aging. Research use only. (PubMed)

Vilon: Entity Properties (for researchers)

Property Details (standardized)
Aliases / Synonyms Vilon; KE; L‑Lys‑L‑Glu; lysylglutamic acid
Family / Pathway Thymic peptide bioregulator (immunomodulatory) (ScienceDirect)
Sequence (AA) Lys–Glu (L‑Lys‑L‑Glu)
Molecular Weight (Da) ~275.3 Da (free dipeptide) (PubChem)
CAS (if applicable) 45234‑02‑4 (L‑Lys‑L‑Glu dipeptide); note the distinct salt L‑lysine·L‑glutamate has CAS 5408‑52‑6 (not the dipeptide). (PubChem)
Typical Diluent(s) Sterile saline or bacteriostatic water (research preparation)
Example Concentration(s) Educational example: 20 mg vial → add 2 mL → 10 mg/mL
Storage Lyophilized: freezer (≤ –20 °C). After reconstitution: 2–8 °C, short‑term (research handling best practices).

Normalization note: You may see “VILON,” “KE,” or “L‑Lys‑L‑Glu.” We standardize to Vilon (Lys‑Glu) and use this consistently below.

Core Concepts & Key Entities

What is Vilon, mechanistically?

Vilon is an ultra‑short peptide that appears to “retune” immune and gene‑expression programs rather than forcing large, drug‑like effects. In cultured lymphocytes, the Lys‑Glu dipeptide significantly increases IL‑2 mRNA, a cytokine central to T‑cell proliferation and function. This effect is concentration‑ and time‑dependent. (PubMed)

At the chromatin level, short bioregulatory peptides—including Vilon—reverse age‑related chromatin tightening in human lymphocytes, a process sometimes described as deheterochromatinization. In older donors, these peptides increase the proportion of transcriptionally active euchromatin and reactivate nucleolar organizer regions that drive ribosomal RNA synthesis and protein production. This likely underpins observed improvements in cellular function with age. (PubMed)

Emerging epigenetics work suggests short peptides can remodel facultative heterochromatin in a selective, sequence‑aware way—a rationale for their tissue‑specific, homeostasis‑favoring actions in aging biology. (PubMed)

Where does Vilon sit among related entities?

Vilon belongs to a set of organ‑derived peptide bioregulators characterized in Russian gerontology programs (e.g., Epitalon from the pineal gland; Thymogen and Thymalin from thymus). These peptides show overlapping but distinct profiles: Vilon is tightly aligned with immune rebalancing and chromatin effects, while Epitalon shows telomerase activation and circadian influences. (ScienceDirect)

Key takeaway: Vilon = immune/epigenetic tuning (IL‑2 + chromatin). Epitalon = telomerase/circadian. Thymogen/Thymalin = broader thymic immune support (with clinical use in some countries). (ScienceDirect)

What outcomes are reported in the literature?

1) Immunomodulation & Inflammatory Tone

Vilon upregulates IL‑2 gene expression in splenic lymphocytes—a direct mechanism for enhancing T‑cell activation and expansion. Broader thymic‑peptide reviews indicate these molecules can act as cytokine “antagonists”/normalizers in inflammatory processes, aligning with a tendency to rebalance, not blunt, immunity. (PubMed)

Human macrophage work using the Vilon dipeptide as one of several test peptides shows modulation of proliferative activity and inflammatory responses, reinforcing a macrophage‑level mechanism relevant to tissue healing and innate immunity. (PMC)

2) Epigenetic “Rejuvenation” of Aged Cells

In lymphocytes from elderly donors, Vilon induces chromatin decondensation, reactivates ribosomal genes, and increases nucleolar organizer activity, changes that support renewed protein synthesis and cellular housekeeping. This epigenetic remodeling is one plausible engine for improved resilience with age. (PubMed)

3) Longevity Signals in Animal Models

In female CBA mice, chronic, low‑dose Vilon initiated in mid‑life increased physical activity and endurance, lowered basal body temperature, reduced spontaneous tumor development, and prolonged lifespan—with no adverse developmental effects even after long‑term use. (PubMed)

4) Gastrointestinal & Metabolic Support Signals (Aging Models)

With oral Vilon in rats, several studies report increased activities of brush‑border enzymes (e.g., maltase, invertase, alkaline phosphatase) and improved glucose/glycine transport—especially in older animals, effectively narrowing age‑related gaps. This points to restoration of digestive/absorptive capacity as organisms age. (PubMed)

Unique insight (information gain): Across these domains, Vilon’s actions fit a two‑phase model: (1) fast transcriptional nudges (e.g., IL‑2 mRNA rise) and (2) slower chromatin remodeling that re‑opens access to growth/repair programs. This phased view helps explain why short cycles can produce durable, system‑level changes even after dosing stops. (PubMed)

Step‑by‑Step (Research How‑To): Preparing Vilon Solutions for Lab Use

What’s the best way to handle Vilon for research? Reconstitute sterilely, label clearly, and store cold to maintain integrity during a short experimental window.

Step 1 — Plan your working concentration

Decide on a working stock that makes downstream aliquoting simple (e.g., reconstituting a 20 mg vial in 2 mL to yield 10 mg/mL). This permits precise, small‑volume pipetting for in vitro assays.

Step 2 — Reconstitute under sterile conditions

Use sterile saline or bacteriostatic water. Direct diluent gently down the vial wall and swirl—don’t shake—to avoid foaming. Let fully dissolve.

Step 3 — Aliquot to minimize freeze–thaw

Split into micro‑aliquots sized to a single day or experiment. Freeze lyophilized stock long‑term (≤ –20 °C). Keep reconstituted solution 2–8 °C and use promptly (research best practice).

Step 4 — Document lots, dates, and concentrations

Label each aliquot with peptide, lot, concentration, and reconstitution date. Record storage conditions to maintain chain‑of‑custody and reproducibility.

Research‑only note: Handling details are provided for laboratory contexts. These peptides are not FDA‑approved therapies; do not construe handling guidance as directions for clinical use.

Comparison & Alternatives (When you’re weighing options)

Bottom line: Choose Vilon when your goal is immune tuning + age‑linked gene‑expression support; consider Epitalon for telomerase/circadian endpoints; Thymogen/Thymalin for broader thymic immune normalization. (PubMed)

Table — How Vilon compares to other peptide bioregulators

Peptide Sequence / Class Primary Signals Reported Where it tends to show best signal
Vilon (KE) Lys‑Glu (dipeptide); thymic bioregulator ↑ IL‑2 gene expression; chromatin decondensation in aged lymphocytes; lifespan extension in mice Immune rejuvenation signals; age‑linked transcriptional remodeling; GI enzyme restoration in aged rats (PubMed)
Epitalon (AEDG) Ala‑Glu‑Asp‑Gly; pineal bioregulator Telomerase activation and telomere elongation in human somatic cells; circadian support Longevity/circadian endpoints; neuroendocrine axes (PubMed)
Thymogen (EW) Glu‑Trp (dipeptide); thymic Immune differentiation; clinical use as immunocorrector in some settings; geroprotective signals in rodents Immune deficits, vaccine responses, adjunct in infections (country‑specific) (PubMed)
Thymalin Thymic peptide complex (polypeptide drug) Broad immune normalization; used clinically in select countries; COVID‑19 immunocorrection studies Systemic immune dysfunction; inflammation control in clinical contexts (PMC)

Templates / Checklist (Copy‑ready for your lab notebook)

Vilon Research Readiness Checklist

  • Verify identity: Confirm L‑Lys‑L‑Glu (Vilon/KE) on the COA; note MW ≈ 275.3 Da and supplier lot. (PubChem)
  • Confirm form: Distinguish dipeptide Vilon (e.g., CAS 45234‑02‑4) from the amino‑acid salt L‑lysine·L‑glutamate (CAS 5408‑52‑6). (PubChem)
  • Set working stock: Plan concentration (e.g., 10 mg/mL) to match assay volumes.
  • Use aseptic technique: Sterile diluent, sterile syringes/pipettes; avoid foaming.
  • Aliquot & label: Single‑use aliquots, labeled with lot, date, and concentration.
  • Store correctly: Lyophilized at ≤ –20 °C; reconstituted at 2–8 °C (short‑term).
  • Track metadata: Record exact dosing to wells/animals and timing in your ELN.
  • Pre‑register endpoints: Define primary readouts (e.g., IL‑2 mRNA, chromatin marks).
  • Plan controls: Include vehicle and, when relevant, an active comparator (e.g., Epitalon for epigenetic benchmarks). (PubMed)
  • Respect scope: Research use only; do not translate lab handling into clinical instructions.

FAQs (Answer‑first, PAA‑style)

What is Vilon?
Vilon is a synthetic dipeptide (Lys‑Glu) studied as a thymic peptide bioregulator that can increase IL‑2 gene expression in lymphocytes and remodel age‑related chromatin in immune cells. It is explored for restoring immune balance and transcriptional activity in aging models. Research use only. (PubMed)

Is Vilon the same as “KE”?
Yes—“KE” is the short‑name code for the Lys‑Glu dipeptide known as Vilon. In the bioregulator literature, KE (Lys‑Glu) is repeatedly referred to as Vilon and grouped with other short peptides like AEDG (Epitalon). (PMC)

How does Vilon work?
Vilon appears to act via two converging mechanisms: (1) IL‑2 gene upregulation in lymphocytes and (2) chromatin decondensation in aged cells, which re‑opens access to silenced genes (e.g., ribosomal DNA) and supports protein synthesis and repair. (PubMed)

Does Vilon increase lifespan?
In female CBA mice, Vilon extended lifespan and reduced spontaneous tumor formation when given chronically from mid‑life, without noted adverse developmental effects. Human longevity data are not available; findings are preclinical. (PubMed)

Is there evidence Vilon helps digestion or metabolism with age?
Yes, in aged rats Vilon increased brush‑border enzyme activities (maltase, invertase, alkaline phosphatase) and improved intestinal transport characteristics, narrowing age‑related deficits versus younger controls. (PubMed)

How is Vilon different from Epitalon?
Epitalon (AEDG) primarily shows telomerase/telomere and circadian effects, while Vilon (Lys‑Glu) shows strong immune and epigenetic‑chromatin effects. They’re often considered complementary in aging research. (PubMed)

Is Vilon safe?
Preclinical data suggest a favorable safety profile, including a long‑term mouse study reporting no adverse developmental effects alongside pro‑longevity signals. As human‑scale trials are limited, Vilon remains research‑only and should be handled accordingly. (PubMed)

Next Steps (for peptide enthusiasts & researchers)

If your objective is immune revitalization and age‑linked gene‑expression support, Vilon is a strong candidate for bench exploration. Start with clear hypotheses (e.g., IL‑2 mRNA, AgNOR counts, rRNA transcription, brush‑border enzyme activity in aging models) and use robust controls.

  • Learn protocols (educational): See our in‑house guide for structuring research cycles and example calculations: Vilon 20 mg Vial Dosage Protocol.
  • Source research‑grade material: For lab‑use procurement, PureLabPeptides offers Vilon (20 mg) here: purelabpeptides.com/buy-vilon-20mg.
  • Stay evidence‑based: Track endpoints aligned with published mechanisms (IL‑2 transcription, chromatin metrics) and report results transparently.

Bottom line: Vilon (Lys‑Glu) is a compact peptide with outsized potential in immune and epigenetic research, showing IL‑2 upregulation, chromatin remodeling, and pro‑longevity signals in animals. Investigate it thoughtfully, and keep the work strictly educational and research‑oriented. (PubMed)

Prostamax is a short synthetic tetrapeptide—Lys‑Glu‑Asp‑Pro (KEDP)—studied as a peptide bioregulator for its capacity to modulate chromatin structure and gene expression, particularly in immune cells and prostate-related models. It’s not an approved therapy; it is a research compound used under laboratory conditions only. (PubMed)

Fast Answer / Executive Summary (40–60 words)

Prostamax (KEDP) is a synthetic tetrapeptide researched for chromatin “de‑heterochromatinization” and gene-expression effects that may normalize age‑related changes in cells, with preclinical data in lymphocytes and prostate models. It remains research‑only (no clinical approvals). Lab handling follows sterile compounding norms (USP <797>) and standard peptide reconstitution practices. (PubMed)

Entity Properties (for researchers; educational only)

Property Details
Aliases / Synonyms Prostamax; KEDP; H‑Lys‑Glu‑Asp‑Pro‑OH; sometimes marketed with the capitalization “ProstaMax” (standardized here as Prostamax)
Family / Pathway Short regulatory “Khavinson” peptides; studied for epigenetic modulation via chromatin remodeling and DNA‑peptide interactions
Sequence (AA) Lys‑Glu‑Asp‑Pro (KEDP)
Molecular Weight (Da) ~487.5 Da
CAS Not assigned in major registries (CAS number not listed in PubChem record)
Typical Diluent(s)* Sterile water for injection; bacteriostatic water (0.9% benzyl alcohol) for multi‑dose research use; 0.9% saline or 0.1% acetic acid may be used for difficult solubility
Example Concentration(s) (educational) Tissue/explant work reported 2–400 ng/mL (notably ~20 ng/mL); rat model: 0.1 μg s.c. daily × 10 days (species‑specific, not for humans)
Storage (lyophilized / after reconstitution) Lyophilized: 4 °C short‑term, −20 °C longer‑term, protect from light; After reconstitution: 2–8 °C for short‑term, avoid repeated freeze–thaw; follow sterile‑compounding SOPs

*Diluent choice is peptide‑ and protocol‑specific; follow institutional SOPs and primary literature.

Sources for table fields: sequence/synonyms/formula (PubChem); chromatin/epigenetic mechanism (peer‑reviewed); explant/animal concentrations and dosing (European patent); diluents and storage (USP <797>, NIBSC guidance, DailyMed label for bacteriostatic water). (PubChem)

Core Concepts & Key Entities

What exactly is Prostamax?

Prostamax is the tetrapeptide Lys‑Glu‑Asp‑Pro (KEDP) studied as a peptide bioregulator that can alter chromatin architecture and gene expression in cells. Human lymphocyte studies observed shifts in chromatin thermal‑denaturation profiles consistent with partial relaxation of condensed chromatin fibers (a proxy for “opening” chromatin). (PubMed)

Standardization note: You may see “ProstaMax,” “KEDP,” or “H‑KEDP‑OH”; these refer to the same tetrapeptide. PubChem lists H‑Lys‑Glu‑Asp‑Pro‑OH and “KEDP” among its synonyms. We standardize to Prostamax (KEDP) in this article. (PubChem)

How is Prostamax thought to work?

Prostamax is investigated for epigenetic activity—specifically, for promoting chromatin de‑heterochromatinization (opening) and ribosomal gene activation—thereby potentially normalizing age‑related chromatin compaction. Short regulatory peptides have been modeled to bind DNA promoter motifs, supporting a plausible gene‑regulatory mechanism. (PubMed)

In older human subjects, Lys‑Glu‑Asp‑Pro exposure increased sister chromatid exchange (SCE) and silver‑stained nucleolar organizer region (AgNOR) activity, changes interpreted as chromatin remodeling. These results complement calorimetry findings showing small but measurable thermal shifts after Prostamax treatment in lymphocyte chromatin. (PubMed)

What does the preclinical evidence suggest?

  • Human lymphocytes (ex vivo/in situ): Prostamax produced 2.9 °C and 1.0 °C downward shifts of two DNA denaturation endotherms, consistent with partial relaxation of 30‑nm chromatin fibers into 10‑nm filaments. Interpretation: chromatin becomes more transcriptionally accessible. (PubMed)
  • Elderly subjects’ lymphocytes: Short peptides (including Prostamax) activated ribosomal genes and decondensed densely packed chromatin regions; Prostamax was among peptides affecting pericentromeric chromatin of specific chromosomes. (PubMed)
  • Aging‑related chromatin remodeling: Independent Georgian Medical News work reported de‑heterochromatinization in aged cohorts treated with Lys‑Glu‑Asp‑Pro, aligning with the concept that selective chromosomal regions are modulated by short peptides. (PubMed)
  • Prostate‑relevant models: A peer‑reviewed European patent details Lys‑Glu‑Asp‑Pro as a tetrapeptide regulating prostate functions in explant and rat chronic bacterial prostatitis models (e.g., 0.1 μg s.c. daily × 10 days), with reported anti‑inflammatory and antioxidant indices. (Patents are not clinical trials but provide primary experimental details.) (Google Patents)

Scope & limits: Evidence remains preclinical (cell/ex vivo/animal). No robust randomized clinical trial evidence demonstrates therapeutic efficacy of Prostamax in humans, and it is not an FDA‑approved drug. (Google Patents)

How does Prostamax relate to other short peptides?

Short regulatory peptides (often called Khavinson peptides) have been studied across tissues for effects on proliferation, apoptosis, and gene regulation. While KED (Lys‑Glu‑Asp; tripeptide) is reported in neurogenesis contexts, KEDP (tetrapeptide) is the prostatically oriented variant discussed here. Both sit within a mechanistic umbrella of short peptides affecting gene expression and chromatin state. (PubMed)

Information‑gain insight: In lab work, Prostamax’s chromatin thermal‑shift signature (ΔTd ≈ −2.9 °C/−1.0 °C) can function as a bench‑level readout to QC the presence of a chromatin‑relaxing effect in lymphocyte assays—an underused, practical marker that links a biophysical change to hypothesized transcriptional accessibility. (PubMed)

Step‑by‑Step / How‑To (Research Handling Only)

Below is a generic educational framework for laboratories working with lyophilized peptides. Always follow your institution’s SOPs, biosafety rules, and local regulations. This is not medical guidance.

H3 — Step 1: Prepare a sterile workspace

Set up in a certified sterile environment compliant with USP <797> (or local equivalent): garbing, aseptic technique, disinfection, and environmental controls. Document BUDs (beyond‑use dates) per risk category and SOP. (Veterans Affairs)

H3 — Step 2: Choose a suitable diluent

Select an appropriate solvent based on peptide properties and protocol: sterile water for injection, bacteriostatic water (0.9% benzyl alcohol) for multi‑dose vialing under sterile technique, isotonic saline, or 0.1% acetic acid for difficult solubility. Confirm compatibility and labeling (e.g., benzyl alcohol content) on official monographs/labels. (DailyMed)

H3 — Step 3: Reconstitute gently

Allow the vial to reach room temperature, swab the septum, and add diluent slowly along the glass wall. Avoid vigorous shaking; swirl or roll to dissolve. For sticky peptides, brief sonication or small increments of solvent may help. (NIBSC)

H3 — Step 4: Prepare a working concentration (example math)

For a 20 mg vial, adding 10 mL yields 2 mg/mL stock. For explant assays, literature examples span 2–400 ng/mL (e.g., 20 ng/mL). Adjust volumes using C1V1=C2V2 and validate with your protocol. (Numbers here are educational and not human dosing.) (Google Patents)

H3 — Step 5: Label, aliquot, and store

Aliquot to minimize freeze–thaw cycles. Lyophilized peptides: store 4 °C (short) to −20 °C (longer‑term), protected from light. After reconstitution: store 2–8 °C for short‑term work per SOP, considering preservative content and sterility risk. (MilliporeSigma)

Compliance reminder: Prostamax is for research use only. Do not use in humans or animals outside approved protocols. Follow institutional biosafety and quality systems (e.g., USP <797> sterile compounding standards where applicable). (Veterans Affairs)

For a worked example of vial math and lab‑focused planning, see PeptideDosages.com’s educational protocol page: Prostamax 20 mg Vial Dosage Protocol.

Comparison / Alternatives (What else is in the landscape?)

Plain‑English takeaway: Prostamax is a research peptide focused on chromatin/epigenetic modulation; clinical BPH/CPPS management relies on well‑studied pharmacologic classes, while saw palmetto remains unsupported by high‑quality trials.

Option What it is Proposed/Primary Mechanism Evidence for prostate/LUTS outcomes Regulatory status
Prostamax (KEDP) Synthetic tetrapeptide bioregulator Chromatin de‑heterochromatinization; gene‑expression modulation Preclinical: lymphocyte chromatin shifts; explant and rat models Research‑only, not FDA‑approved
α‑blockers (e.g., tamsulosin) Rx class for BPH/CPPS Relax prostatic/urethral smooth muscle RCTs/guidelines: can reduce CP/CPPS & LUTS in select patients FDA‑approved drugs; guideline‑directed use
Saw palmetto (Serenoa repens) Herbal supplement 5‑α‑reductase inhibition (proposed) High‑quality trials & Cochrane: no meaningful benefit vs placebo OTC supplement; not a drug
Prostate peptide extracts (e.g., Prostatilen/Samprost) Extracted polypeptide mixtures Tissue‑derived peptides; variable composition Mostly regional legacy data; limited high‑quality RCTs Not FDA‑approved in the U.S.

Key sources: Prostamax mechanism/evidence (Biofizika 2004; BExpBiolMed 2004; GMN 2012; patent); α‑blockers in CP/CPPS (AUA guidance; meta‑analyses); saw palmetto (NEJM 2006; JAMA 2011; NCCIH spotlight; Cochrane 2023). (PubMed)

Templates / Checklist / Example

Copy‑ready Lab Checklist (educational; adapt to your SOPs)

  • Verify research‑only status and IRB/IACUC or institutional approvals where applicable.
  • Confirm peptide identity (COA, sequence KEDP, lot, purity).
  • Review relevant primary literature and define target working concentrations (e.g., explant ng/mL ranges). (Google Patents)
  • Prepare sterile workspace per USP <797> (garbing, cleaning, airflow, logs). (Veterans Affairs)
  • Select a compatible diluent (sterile water; bacteriostatic water 0.9% benzyl alcohol if multi‑dose; saline; 0.1% acetic acid when appropriate). (DailyMed)
  • Calculate stock and working solutions (C1V1=C2V2); record exact volumes.
  • Reconstitute gently (swirl; avoid foam); note appearance/clarity. (NIBSC)
  • Aliquot to reduce freeze–thaw; label with concentration, diluent, date, BUD. (Veterans Affairs)
  • Store lyophilized at 4 °C/−20 °C; reconstituted at 2–8 °C; protect from light. (MilliporeSigma)
  • Document method, deviations, and disposal per biosafety rules.

FAQs (NLP‑friendly, snippet‑optimized)

What is Prostamax?
Prostamax is the tetrapeptide Lys‑Glu‑Asp‑Pro (KEDP) investigated as a peptide bioregulator that can relax heterochromatin and influence gene expression in cell models; it remains research‑only and is not approved for treating disease. (PubMed)

Is Prostamax the same as a saw‑palmetto “ProstaMax” supplement?
No—Prostamax (KEDP) is a synthetic research peptide, whereas some products called “ProstaMax” are herbal (e.g., saw palmetto blends). These are unrelated categories with different evidence and regulation. (Laboratoire THERASCIENCE)

What human data exist on Prostamax?
Human data are limited to ex vivo/in situ lymphocyte and chromatin studies, which report small but measurable thermal shifts (e.g., −2.9 °C, −1.0 °C) and chromatin remodeling indicators. There are no robust randomized human trials for clinical endpoints. (PubMed)

What concentrations/doses were used in preclinical work?
Preclinical reports used 2–400 ng/mL in explants (with ~20 ng/mL often effective) and 0.1 μg s.c. daily × 10 days in rats with induced prostatitis. These are not human dosing guidelines and are presented only for laboratory context. (Google Patents)

Does Prostamax have a CAS number?
A CAS Registry Number is not listed for Prostamax in major databases, such as the PubChem record, which catalogs synonyms (e.g., “H‑KEDP‑OH”) and structure without a CAS entry. (PubChem)

Is saw palmetto effective for BPH compared with standard drugs?
Large, high‑quality trials and reviews show saw palmetto does not outperform placebo for LUTS/BPH, while α‑blockers have evidence‑based roles in guidelines for appropriate patients. (New England Journal of Medicine)

Next Steps

Bottom line: Prostamax (KEDP) is a research‑only peptide with preclinical evidence of chromatin remodeling; it is not a medical treatment. For lab planning and vial math examples, see our internal guide: Prostamax 20 mg Vial Dosage Protocol. For research supply, PureLabPeptides lists Prostamax 20 mg (research use only).

This blog is written by and will be posted on PeptideDosages.com. Educational content only; no medical advice.

Ovagen refers to a synthetic ultra‑short peptide marketed in research circles as the tripeptide Glu‑Asp‑Leu (EDL)—a member of the “peptide bioregulator” family originally explored by Khavinson and colleagues. These peptides are studied for organ‑directed gene‑expression effects, with Ovagen positioned for liver and gastrointestinal (GI) research. Evidence for the EDL motif includes resolved enzyme‑binding structures (HIV‑1 protease) and a broader body of peer‑review showing how ultra‑short peptides can enter cells, interact with DNA/histones, and modulate transcription relevant to tissue recovery and aging biology. Educational details, comparisons, and a research‑use checklist follow. (RCSB Protein Data Bank)

Fast Answer / Executive Summary (40–60 words)

Ovagen is a research‑grade, ultra‑short peptide most commonly described as the tripeptide Glu‑Asp‑Leu (EDL) associated with liver/GI bioregulation. Ultra‑short peptides can penetrate cells and influence gene expression; EDL itself is structurally documented binding an enzymatic active site (HIV‑1 protease), illustrating precise, sequence‑specific bioactivity. Use is educational/research‑only. (MDPI)

Ovagen / EDL — Entity Properties (educational)

Note on naming: “Ovagen” is used in research‑market contexts for the EDL tripeptide (Glu‑Asp‑Leu). It is distinct from similarly named FSH‑based fertility products in agriculture/medicine.

Property Detail
Aliases / Synonyms Ovagen (research peptide), EDL, Glutamyl‑aspartyl‑leucine (tripeptide)
Family / Pathway Ultra‑short peptide bioregulator; mechanistic literature centers on nuclear/epigenetic gene‑expression modulation and peptide transporter uptake (e.g., PEPT family) rather than classic receptor agonism. (MDPI)
Sequence (AA) Glu–Asp–Leu (three L‑amino acids)
Molecular Weight (Da) ~375.4 Da (average; calculated for H‑Glu‑Asp‑Leu‑OH). As a reference entry for the same tripeptide motif, see PubChem CID 444128. (PubChem)
CAS (if applicable) No widely used single CAS entry for the brand. For the chemical tripeptide entity, refer to PubChem CID above. (PubChem)
Typical Diluent(s) Sterile water for injection or bacteriostatic water (research convention). General peptide‑handling guidance favors sterile, low‑microbial diluents. (NIBSC)
Example Concentration(s) Educational example only: 20 mg vial reconstituted in 3 mL ≈ 6.7 mg/mL (dose volumes then calculated from mg target).
Storage Lyophilized: cool, dry, light‑protected (≤ –20 °C for long term). After reconstitution: short‑term 2–8 °C; avoid repeated freeze‑thaw; aliquot if needed. (General peptide guidance.) (NIBSC)

Core Concepts & Key Entities

What does “peptide bioregulator” mean in this context?

A peptide bioregulator is a very short peptide (2–7 amino acids) shown to enter cells and influence gene expression, often with tissue‑selective effects. Multiple peer‑reviewed studies and reviews (spanning molecular biology, gerontology, and epigenetics) document that ultra‑short peptides can translocate to nuclei, bind DNA/histones, and remodel chromatin, thereby up‑ or down‑regulating specific genes involved in cellular maintenance, stress response, and differentiation. These mechanisms offer a plausible basis for organ‑directed effects attributed to different peptide sequences. (MDPI)

Mechanistic pillars supported in the literature:

  • Cellular entry & transport: Ultra‑short peptides are taken up via peptide transporters (e.g., PEPT1/2, LAT family) and can reach intracellular compartments, including the nucleus. (PMC)
  • Chromatin & gene expression: Short peptides have been shown to bind DNA/histones and remodel heterochromatin, with human lymphocyte data indicating selective de‑condensation of aging‑associated “old” chromatin regions—restoring transcriptional activity in seniors (75–88 years). (PubMed)
  • Transcriptional outcomes: Independent groups have reported up‑regulation of functional genes (e.g., neurogenesis, circadian, stress response) after exposure to canonical ultra‑short peptides (AEDG/Epitalon, KED/Vilon), supporting the general bioregulatory action mode that Ovagen is grouped within. (MDPI)

Why this matters for “Ovagen”: If a tripeptide’s sequence is known to interact with nucleic targets and remodel chromatin (as a class property), an EDL‑based agent plausibly normalizes expression in liver/GI‑relevant pathways, the proposed use‑case for Ovagen in research settings. Mechanism is regulatory, not stimulant. (MDPI)

What evidence exists specific to the EDL motif associated with Ovagen?

The EDL tripeptide (Glu‑Asp‑Leu) is crystallographically resolved in complex with HIV‑1 protease and inhibits this enzyme in vitro in the micromolar range, confirming that EDL is bioactive and sequence‑specific (a rare property for such a small peptide). Structural biology entries and classic enzymology work report Ki ≈ 50 µM for EDL and ≈ 20 µM for EDP (Glu‑Asp‑Phe) against HIV‑1 protease; the same EDL motif is documented in the protease’s transframe region and used in mechanistic studies of PR processing. While not an antiviral drug, this high‑specificity binding illustrates the principle that ultra‑short sequences can engage defined molecular targets—a rationale often invoked for organ‑targeted regulatory effects of short peptides. (RCSB Protein Data Bank)

Information gain: Many peptide overviews skip hard structural data. EDL’s crystallographic documentation and Ki values show EDL is not a generic “supplement” but a chemically tractable, target‑engaging motif—bolstering confidence when considering its inclusion in research designs. (RCSB Protein Data Bank)

What about liver‑directed outcomes and aging biology?

Direct, peer‑reviewed data on “Ovagen‑branded” interventions are limited, but closely related short peptides in the Khavinson canon show liver‑relevant effects:

  • Livagen (KEDA; Lys‑Glu‑Asp‑Ala) increased protein synthesis in cultured rat hepatocytes, most strongly in older animals, an age‑bias consistent with chromatin remodeling data. (PubMed)
  • Livagen modulated digestive enzyme activity in rodent small intestine (age‑dependent, oral dosing), suggesting GI tract relevance along the gut‑liver axis. (PubMed)
  • Epigenetic remodeling in elderly human lymphocytes (AEDG/Epitalon, KEDA/Livagen, others) supports the broader geroprotective hypothesis: short peptides can de‑heterochromatinize aging chromatin, restoring transcriptional capacity of previously silenced loci. (PubMed)

Context: Independent pharmacology reviews highlight anti‑fibrotic pathways (e.g., oxidative stress and stellate‑cell signaling) as core liver‑repair targets generally; while EDL‑specific anti‑fibrotic trials are lacking, research‑grade liver peptides are often explored precisely to shift these repair/inflammation axes via gene‑regulatory means. (PMC)

Bottom line: In the absence of head‑to‑head clinical trials for EDL/Ovagen, the weight of evidence supports the plausibility that an EDL‑based agent belongs to a mechanism class (ultra‑short peptides) capable of transcriptional normalization in tissues relevant to liver/GI outcomes—with the strongest signals historically observed in aging models/subjects. (MDPI)

Step‑by‑Step (Educational) — Designing Research Use

Important: The following is educational guidance for laboratory/research contexts—not medical advice or instruction for human treatment. Where specifics (e.g., storage) are given, they follow general peptide‑handling guidance rather than Ovagen‑specific clinical labeling.

Step 1 — Plan the Objective & Metrics (before you touch the vial)

  1. Define the outcome variables you’ll track (e.g., hepatocyte assays, inflammatory readouts, or—in athletic models—post‑stress recovery markers).
  2. Decide the exposure window (e.g., 10–30 days) based on your model’s turnover rate; ultra‑short peptides often show cumulative effects tied to chromatin remodeling, not immediate stimulation. (MDPI)

Step 2 — Reconstitution (sterile technique; example only)

  1. Set a working concentration. A common educational example for a 20 mg vial is 3 mL sterile diluent → ~6.7 mg/mL.
  2. Use sterile water for injection or bacteriostatic water in a laminar‑flow hood or clean field. Add slowly down the vial wall and gently swirl (no vigorous shaking). Label concentration/date. (General peptide practice.) (NIBSC)

Step 3 — Storage & Stability (general peptide guidance)

  1. Lyophilized stock: Store cool, dry, light‑protected (≤ –20 °C for long‑term).
  2. After reconstitution: Use 2–8 °C for short‑term working solutions; avoid repeated freeze–thaw; aliquot if the study extends beyond days to a few weeks. These are standard peptide‑handling rules from public laboratories, not Ovagen‑specific labeling. (NIBSC)

Step 4 — Dosing Pattern (how researchers structure exposure)

  1. Front‑loaded cycles are common with ultra‑short peptides (e.g., daily or near‑daily exposure over 10–20 days) to allow transcriptional programs to reset, followed by an off‑period for observation. This mirrors designs used with AEDG/KEDA in aging models and human observational work. (PubMed)
  2. Age‑context: If your model emulates older biology, anticipate larger deltas (e.g., protein synthesis in old hepatocytes responding more than young in KEDA work). Design statistical power accordingly. (PubMed)

Step 5 — Record, Iterate, and Report

  1. Capture pre/post baselines (biomarkers, functional outputs).
  2. Iterate only after washout; because changes are regulatory, you may see lagged effects as chromatin state equilibrates. (PubMed)

Internal resource: For a worked example of vial math and cycle planning, see PeptideDosages.com’s educational guide: Ovagen 20 mg vial dosage protocol.

Comparison / Alternatives (where does Ovagen fit?)

Answer first: Ovagen (EDL) sits among ultra‑short bioregulator peptides studied for organ‑directed effects; Livagen (KEDA) has the most liver‑specific preclinical data; Epitalon (AEDG) is the most‑studied global geroprotective. Use depends on whether your research focus is liver/GI targeted (EDL/KEDA) or systemic aging/chromatin (AEDG). (PubMed)

Feature Ovagen (EDL; Glu‑Asp‑Leu) Livagen (KEDA; Lys‑Glu‑Asp‑Ala) Epitalon (AEDG; Ala‑Glu‑Asp‑Gly)
Primary emphasis in literature EDL motif binds defined enzyme targets (HIV‑1 protease) → demonstrates specific bioactivity. Liver/GI positioning is extrapolated from the bioregulator class + practice. (RCSB Protein Data Bank) Liver‑centric data: ↑ protein synthesis in old hepatocytes; age‑modulated GI enzyme effects. (PubMed) Systemic geroprotective with gene‑expression changes across tissues (pineal/brain/retina). (PMC)
Mechanistic class Ultra‑short peptide; transporter‑mediated uptake; chromatin/DNA/histone interactions (class evidence). (PMC) Same class, with specific liver and GI readouts published. (PubMed) Same class, widely profiled for epigenetic and circadian gene effects. (PMC)
Signal strongest in Conceptual liver/GI models; structural target engagement (HIV‑PR) shows potency for short sequences. (RCSB Protein Data Bank) Aging hepatocyte models; older tissue responds most. (PubMed) System‑wide aging endpoints and circadian/neuronal markers. (PMC)
Half‑life context Ultra‑short peptides are typically rapidly cleared; repeated short courses are common research designs. (General peptide pharmacology.) (Exploration Publishing) Similar Similar
Best‑fit research use EDL as liver/GI bioregulation probe where you want precise sequence bioactivity and transporter‑/chromatin‑driven hypotheses. Liver outcomes with age interaction; GI enzyme dynamics. Global aging biology; reference compound for ultra‑short peptide epigenetics.

Templates / Checklist / Example

Copy‑ready Research Checklist (concise)

  • Define your primary endpoint(s) (e.g., hepatocyte function, inflammatory readouts).
  • Confirm material identity (lot, purity, sequence paperwork).
  • Calculate reconstitution to a round mg/mL for error‑proof aliquoting.
  • Follow sterile technique for all reconstitutions and transfers. (NIBSC)
  • Store lyophilized stock cold/dry/dark; aliquot solutions and keep at 2–8 °C short‑term. (NIBSC)
  • Pre‑register a cycle plan (e.g., 10–20 days exposure, then washout).
  • Stratify by age where relevant; expect larger deltas in older models. (PubMed)
  • Instrument your study with baseline & post‑course assays.
  • Document any confounders (diet, training load, concomitant agents).
  • Report transparently: include negative or null findings; these inform dosing and timing in future work.

FAQs (NLP‑friendly, answer‑first; 40–80 words each)

What is Ovagen? Ovagen is the research‑market name most often used for the ultra‑short peptide tripeptide Glu‑Asp‑Leu (EDL), grouped with “peptide bioregulators.” Bioregulator peptides are studied for cellular entry, chromatin interactions, and gene‑expression effects that can be organ‑biased. EDL has crystal‑level evidence of specific enzyme binding, supporting the concept that very short sequences can be bioactive. (MDPI)

How does Ovagen (EDL) “work”? Mechanistically, ultra‑short peptides can be transported into cells, reach the nucleus, and modulate chromatin/DNA interactions that change gene expression. This regulatory action is distinct from receptor agonism and often shows greater impact in older systems where chromatin is more condensed. EDL’s documented enzyme binding further illustrates sequence‑specific biological action. (PMC)

Is there liver‑specific evidence? Direct EDL/Ovagen liver trials are sparse; however, closely related short peptides show liver/GI effects. The tetrapeptide Livagen (KEDA) increased hepatocyte protein synthesis in old rats and modulated intestinal enzyme activity with age‑dependence—findings consistent with the class’s chromatin remodeling in aged human cells. These data justify liver/GI‑focused study designs for EDL. (PubMed)

Does EDL fight viruses? No clinical antiviral claim is supported; however, EDL inhibits HIV‑1 protease in vitro and is crystallized in the protease active site. That shows target‑level specificity at micromolar potency but does not translate to proven antiviral efficacy in humans. It’s mechanistic evidence, not a therapeutic endorsement. (RCSB Protein Data Bank)

How should researchers store and handle it? Follow general peptide handling: keep lyophilized material cold (≤ –20 °C), dry, and in the dark; keep reconstituted solutions 2–8 °C short‑term, avoid freeze–thaw, aliquot early, and use sterile technique. These guidelines are general peptide best practices from public laboratory references. (NIBSC)

Is this medical advice? No. All information here is educational and intended for research‑use planning. Ovagen/EDL is not an FDA‑approved drug for any indication; any human use should be evaluated by qualified professionals and within applicable laws/ethics.

Next Steps

If your project requires an EDL‑based peptide for liver/GI research, the most practical path is to secure a high‑purity source and implement a monitored, time‑bounded exposure cycle. Start with clear endpoints, apply sterile handling, and track outcomes transparently.

Key takeaway: Ultra‑short peptides like EDL (Ovagen) are best understood as regulators—tools to nudge gene expression and tissue programs—rather than brute‑force stimulants. Build your protocol to detect gradual, regulatory changes, particularly in models of aging or post‑stress recovery. (MDPI)

MGF (Mechano Growth Factor) is a locally acting splice variant of the IGF‑1 gene (human IGF‑1Ec; rodent IGF‑1Eb) that is upregulated by mechanical stress and tissue injury. It helps initiate repair by activating resident stem/progenitor cells—most notably muscle satellite cells—and shows context‑specific roles in skeletal muscle, heart, and brain in preclinical models. (PubMed)

Fast Answer — Executive Summary (40–60 words).
MGF is an IGF‑1 splice variant that rises in tissue after mechanical stress to “prime” regeneration by expanding local progenitor cells, especially in muscle. In humans, MGF (IGF‑1Ec) increases within hours after resistance exercise—an effect blunted with aging—and it differs mechanistically and temporally from systemic IGF‑1. Evidence remains preclinical and mixed. (PubMed)

Entity Properties (Educational)

Property Details
Aliases/Synonyms Mechano Growth Factor (MGF); IGF‑1Ec (human), IGF‑1Eb (rodent) (PubMed)
Family/Pathway Alternative splice variant of IGF‑1; part of the GH/IGF axis; produced and acts locally (autocrine/paracrine) after load/injury (PMC)
Sequence (AA) Human MGF E‑domain peptide (24 aa): YQPPSTNKNTKSQRRKGSTFEEHK (synthetic form used in several studies) (PMC)
Molecular Weight (Da) ~2,847 Da (calculated from the 24‑aa sequence above; monoisotopic)
CAS (if applicable) Not assigned for the 24‑aa research peptide (isoform‑specific E‑domain)
Typical Diluent(s) Sterile saline or buffered saline in preclinical models (e.g., osmotic‑pump infusion in mice; intracoronary delivery in sheep). Cell‑culture studies commonly use aqueous buffers. (PMC)
Example Concentration(s) In vitro: 100 nM E‑peptides used to study signaling and myoblast behavior. In vivo: continuous infusion ~4.5 mg/kg/day of stabilized MGF E‑peptide in post‑MI mouse models. (Illustrative, research‑only.) (PLOS)
Storage (lyophilized / after reconstitution) Lyophilized peptides are generally more stable when kept cold and dry (low temperature, protection from moisture/light). In solution, stability is shorter; minimize time at ambient conditions. (General peptide‑stability guidance.) (PMC)

Normalization note: You may see “IGF‑1Eb/Ec,” “MGF‑E,” or “MGF‑24aa‑E.” We standardize to MGF (IGF‑1Ec) for human and use MGF E‑domain peptide for the 24‑amino‑acid synthetic research fragment. (PLOS)

Core Concepts & Key Entities

What is MGF at the gene level? MGF is an alternative 3′ splice variant of the IGF‑1 gene that encodes a distinct C‑terminal E‑domain (Ec in humans). Mechanical overload and injury shift IGF‑1 splicing toward this variant in the affected tissue. The MGF mRNA pulse is rapid, preceding (and differing from) the later rise of “classical” IGF‑1Ea. (Physiology Journals)

Where does MGF show up physiologically? Skeletal muscle is the canonical site: MGF mRNA increases within ~2–3 h after heavy resistance exercise in young adults but is attenuated in older adults. Rodent studies report similar “first‑responder” dynamics after damage or GH perturbation. (PubMed)

How is MGF different from circulating IGF‑1? IGF‑1 is a 70‑aa hormone that circulates and signals via IGF‑1 receptor (IGF‑1R) in many tissues. MGF is produced locally and is thought to prime regeneration by expanding progenitor pools; its E‑peptide biology (and receptor usage) is distinct and still debated. (Physiology Journals)

Related entities: IGF‑1 (IGF‑1Ea), E‑peptides/E‑domains, satellite cells (muscle stem cells), PEG‑MGF (pegylated MGF analogs), and MAPK/ERK signaling often appear in the MGF literature. (PLOS)

What MGF Does (Mechanism → Outcomes)

MGF acts as an early, local “prime” for regeneration by expanding progenitor cells and modulating repair signaling. In skeletal muscle, the MGF E‑domain peptide can increase proliferation and delay differentiation of human muscle progenitors in vitro—conceptually supplying more building blocks for later regeneration. (PubMed)

Is MGF independent of the IGF‑1 receptor? Evidence is conflicting across models:

  • Independent effects reported: The MGF C‑terminal peptide showed neuroprotection in ischemia models without classical IGF‑1–like behavior, suggesting distinct signaling. (PubMed)
  • Dependent/modulatory effects reported: E‑peptide activity (including MGF‑like EB peptides) often requires IGF‑1R and can tune IGF‑1 signaling toward MAPK/ERK, not AKT, in myoblasts. (PLOS)
  • Full‑length MGF vs. E‑peptide: Full‑length pro‑IGF‑1Ec (MGF) can activate IGF‑1R at higher concentrations in vitro, blurring boundaries between “independent” and “modulatory” models. (PLOS)

Key practical takeaway: MGF’s regenerative role is best framed as a short‑lived, local signal that cooperates with (not replaces) IGF‑1—amplifying pro‑proliferative cascades early so differentiation and tissue rebuilding can proceed later. This “prime‑then‑build” sequence aligns with observed early MGF and later IGF‑1Ea expression kinetics after load. (PubMed)

How long does MGF last? In cell media, the E‑peptide analogous to MGF (EB) exhibits a short full‑length half‑life (~20 min) before proteolysis, with fragments persisting longer—underscoring why many in vivo studies stabilize or modify the peptide. (PLOS)

Therapeutic Implications (What the Data Actually Show)

Bottom line: MGF is promising but preclinical. Several animal and cell studies support regenerative or cytoprotective roles; human outcome data are lacking, and some experiments report null effects of synthetic MGF on muscle cells.

Skeletal Muscle: Recovery & Hypertrophy

  • Acute exercise studies (humans): After heavy resistance exercise, MGF mRNA rises in young muscle (∼2.5 h post‑session) while older adults show a blunted MGF response—one plausible factor in age‑related recovery differences. (PubMed)
  • Mechanistic cell data: The MGF E‑peptide can increase proliferation and fusion potential of human muscle progenitors in vitro, consistent with a “more cells to repair” model. (PubMed)
  • Regeneration timing: During muscle damage/regeneration cycles, IGF‑1 isoforms change over time—with MGF/Ec expression in early phases and IGF‑1Ea later as fibers mature. (IIAR Journals)
  • Contradictory results: A rigorous study found no apparent effect of synthetic MGF peptide on myoblast proliferation or primary muscle stem cells, highlighting model/peptide‑chemistry sensitivity and caution in extrapolation. (Physiology Journals)

Heart: Injury & Remodeling

  • Myocardial infarction (mice): Continuous delivery of a stabilized 24‑aa MGF E‑peptide preserved cardiac function and delayed decompensation after MI—both in acute and chronic windows. (PMC)
  • Localized cardiac delivery: Cardiac‑restricted administration (polymeric microstructures) of MGF E‑domain peptide mitigated adverse remodeling, supporting local‑delivery strategies. (PMC)

Brain & Nerve: Neuroprotection and Aging

  • The MGF C‑terminal peptide showed strong neuroprotection in ischemia models, reducing neuronal death in vivo and in vitro. (PubMed)
  • MGF expression appears in neurogenic brain regions and declines with age in mice; overexpression improved specific neural measures—suggesting a role in neural progenitor dynamics. (BioMed Central)

Other Tissues

  • MGF‑related signaling has been explored in connective tissue/cellular migration and vascular contexts, though translation is preliminary. (Journal of Molecular Endocrinology)

Evidence grade: Most results are preclinical (cells/rodents/large animals). Human therapeutic evidence is absent, and the synthetic peptides used can differ (sequence length, modifications), affecting outcomes. Balance enthusiasm with skepticism. (OUP Academic)

Step‑by‑Step (Educational) — Designing an MGF Research Workflow

What’s the practical, educational “how‑to”? Design around MGF’s short‑lived, local biology: choose models, dosing windows, and endpoints that capture early proliferative effects and later differentiation separately.

1) Define the model and window you want to study

Pick in vitro (human myoblasts/myogenic progenitors) for mechanistic endpoints or in vivo injury/overload models (e.g., post‑MI mice, muscle injury). Time your sampling to early hours to days post‑stimulus where MGF/Ec dynamics appear. (PubMed)

2) Choose the form of MGF and validate identity

Decide between full‑length pro‑IGF‑1Ec vs 24‑aa E‑domain peptide. Verify sequence (e.g., YQPPSTNKNTKSQRRKGSTFEEHK) and purity (HPLC/MS). Note that full‑length Ec can activate IGF‑1R at high concentrations; E‑peptides often modulate IGF‑1R signaling. (PMC)

3) Set concentrations and controls (anchored to literature)

For cells, start in the 10–100 nM range (commonly used to probe E‑peptide biology) with vehicle and IGF‑1 comparators. If in vivo, reference prior dosing paradigms (e.g., continuous infusion ~4.5 mg/kg/day post‑MI mice) and include sham and IGF‑1 arms. (PLOS)

4) Plan readouts that map to “prime‑then‑build”

Early: proliferation markers (EdU/BrdU, Ki‑67), satellite cell counts, MAPK/ERK activation. Later: myogenic differentiation (Myogenin, MyHC), fiber cross‑sectional area, functional metrics (force, ejection fraction for heart). (PLOS)

5) Use appropriate vehicles and delivery

For cells: aqueous buffers compatible with viability. For animal models: sterile saline or buffered saline (as in cardiac studies) and delivery that matches your hypothesis (local vs systemic). Record pH/osmolality to reduce confounders. (PMC)

6) Address stability up front

E‑peptides are labile (e.g., EB half‑life ~20 min in media). Minimize bench time in solution; consider stabilization (e.g., D‑Arg substitutions, amidation) when scientifically justified, and document it transparently. (PLOS)

7) Store and handle like any research peptide

Keep lyophilized peptide cold and dry; protect from moisture/light; limit freeze–thaw. Use fresh aliquots for reconstituted solutions. These are general peptide‑stability best practices from biopharmaceutics literature. (PMC)

Compliance note: MGF is a research peptide. No human therapeutic indications are approved. MGFs and IGF‑1 are prohibited in sport (WADA S2); competitive athletes must avoid use. (Wada-Ama)

Comparison / Alternatives

Answer first: MGF is a local, short‑window primer; IGF‑1 is a systemic builder; PEG‑MGF seeks longer exposure via chemistry, but direct clinical data for PEG‑MGF are lacking. (Physiology Journals)

Feature MGF (IGF‑1Ec / E‑domain) IGF‑1 (IGF‑1Ea / mature 70‑aa) PEG‑MGF (pegylated MGF analog)
Biological role Early, local response to load/injury; expands progenitor pools (pro‑proliferative) Endocrine/paracrine growth factor; drives differentiation and anabolic signaling broadly Designed to prolong MGF exposure via PEG; preclinical/pharmacologic rationale, limited peptide‑specific PK data
Receptor behavior E‑peptide effects often modulate/require IGF‑1R; full‑length Ec can activate IGF‑1R at high concentration; literature mixed Binds IGF‑1R with well‑characterized downstream AKT & MAPK pathways PEGylation typically extends half‑life and reduces clearance for peptides/proteins (general principle)
Temporal profile Short‑lived; E‑peptides are labile in media/tissues Longer‑lived (binding proteins prolong exposure) Prolonged vs native MGF (by design)
Evidence base Cell/animal data; mixed findings across assays Robust physiology; approved drug forms for specific deficiencies (outside this article’s scope) Concept supported by PEG literature; no standardized human PK/efficacy for PEG‑MGF
Use context Local delivery post‑injury/overload in models Systemic actions; broad anabolic/metabolic roles Hypothetical reduced dosing frequency if PK extended

Citations (table synthesis): MGF early/local kinetics and aging effect (J Physiol 2003); E‑peptide dependence on IGF‑1R (PLOS One 2012); full‑length Ec activating IGF‑1R (PLOS One 2016); short‑lived E‑peptide (PLOS One 2012); PEGylation extends peptide half‑life (general) (Expert Opin Drug Deliv, Front Pharm 2024). (PubMed)

Templates / Checklist (Copy‑Ready)

Educational MGF Research Planning Checklist

  • Define the question (e.g., “Does MGF expand satellite cells after acute overload?”).
  • Select the form (full‑length IGF‑1Ec vs 24‑aa E‑domain); document modifications. (PMC)
  • Choose comparators (vehicle, IGF‑1, possibly stabilized analogs). (PLOS)
  • Anchor concentrations to literature (10–100 nM for cells; published mg/kg/day regimens for animals). (PLOS)
  • Time your sampling to capture early proliferation and later differentiation phases. (PubMed)
  • Pre‑register endpoints (e.g., Ki‑67, Myogenin, ERK/Akt, function). (PLOS)
  • Plan delivery (e.g., local vs systemic; saline vehicles consistent with prior studies). (PMC)
  • Mitigate instability (aliquot, cold chain, minimize bench time); consider stabilized analogs where justified. (PLOS)
  • Follow storage best practices (lyophilized cold/dry; fresh solutions). (PMC)
  • Document ethics & compliance; avoid prohibited use in sport (WADA S2). (Wada-Ama)

FAQs (NLP‑Friendly, Answer‑First)

What is MGF?
MGF is an IGF‑1 splice variant (IGF‑1Ec) that rises locally after mechanical stress to prime tissue repair by expanding progenitor cells, especially in muscle. It is distinct from circulating IGF‑1 in timing and likely in signaling nuance. Evidence is largely preclinical. (PubMed)

Is MGF the same as IGF‑1?
MGF is not the same as IGF‑1; MGF is a locally acting splice variant with a unique E‑domain. IGF‑1 is systemic and binds the IGF‑1 receptor to drive differentiation and growth, whereas MGF surges early, locally, and emphasizes progenitor expansion. (PubMed)

Does MGF act through the IGF‑1 receptor?
MGF’s receptor story is mixed. Several studies show E‑peptide actions require or modulate IGF‑1R, while full‑length IGF‑1Ec can ligate IGF‑1R at higher concentrations; other reports describe IGF‑1R‑independent effects in specific neural models. (PLOS)

Is MGF banned in sports?
Yes. MGFs and IGF‑1 (and analogs) appear on the WADA Prohibited List (S2). Athletes subject to anti‑doping rules should not use MGF in any form. (Wada-Ama)

How stable is MGF in solution?
E‑peptides analogous to MGF degrade quickly in biological media (full‑length EB half‑life ~20 min in vitro); many studies therefore use stabilized analogs or delivery systems. Store lyophilized peptide cold/dry and limit time in solution. (PLOS)

What is PEG‑MGF and why is it used?
PEG‑MGF is a pegylated MGF analog designed to extend exposure by slowing clearance—consistent with how PEGylation prolongs half‑life for many peptides/proteins. Direct human PK/efficacy data for PEG‑MGF are not established. (PMC)

Next Steps

If you’re evaluating MGF academically or for laboratory research, center your design on early, local effects and use rigorous controls against IGF‑1. Treat every claim skeptically—the literature contains both positive and null findings depending on peptide form and model. No human therapeutic indications are established. (Physiology Journals)

For researchers seeking test materials, ensure supplier transparency (identity, purity analytics). For educational reference, MGF (2 mg) for research use is available from PureLabPeptides: purelabpeptides.com/buy-peptides/buy-mgf-2mg/.

Key take‑home: MGF appears to “prime” regeneration (especially in muscle) with a short, local signal that likely cooperates with IGF‑1; translating that into therapy will require standardized peptides, delivery, and human trials. (PubMed)

Mazdutide (also known as IBI‑362 or LY3305677) is a once‑weekly dual agonist of the GLP‑1 and glucagon receptors modeled on oxyntomodulin. In phase 2 and 3 studies, mazdutide produced clinically meaningful weight loss alongside improvements in multiple metabolic markers; China granted its first approvals in 2025. This article explains how it works, what the data show, and how researchers can design high‑quality studies. (Nature)

Fast Answer / Executive Summary (40–60 words):
Mazdutide is a once‑weekly, oxyntomodulin‑based peptide that co‑activates GLP‑1 and glucagon receptors to reduce appetite and increase energy expenditure, driving clinically relevant weight loss and broader metabolic benefits in randomized trials. It received first marketing approvals in China in 2025 for chronic weight management and for glycemic control in adults with type 2 diabetes. (PubMed)

Entity Properties (for researchers)

Property Detail (educational)
Aliases / Synonyms Mazdutide; IBI‑362; LY3305677
Family / Pathway Dual GLP‑1R / GCGR agonist (oxyntomodulin analog)
Sequence (AA) Exact manufacturer sequence not publicly disclosed; mammalian oxyntomodulin–analog peptide with lipidation to prolong half‑life (albumin binding); reports note the use of non‑canonical residues typical of co‑agonists (e.g., Aib) and fatty‑acid acylation. (MDPI)
Molecular Weight (Da) ~4476 g/mol (PubChem computed)
CAS 2259884‑03‑0
Typical Diluent(s) Not standardized in public literature; follow supplier COA and study protocol (e.g., sterile buffered aqueous systems for in‑vivo/in‑vitro research).
Example Concentrations (educational) Not specified in peer‑reviewed literature; determine by protocol (pilot tolerability/PK data first).
Storage (lyophilized / after reconstitution) Per product COA; conditions vary by formulation. Avoid repeated freeze‑thaw cycles.
Notes Once‑weekly dosing supported by lipidation and pharmacokinetics typical of long‑acting incretin analogs. (PubChem)

Core Concepts & Key Entities

What is Mazdutide? Mazdutide is a dual GLP‑1/glucagon receptor agonist designed to combine GLP‑1–mediated appetite and glycemic effects with glucagon‑mediated increases in energy expenditure, a synergy observed with the natural gut hormone oxyntomodulin. This design aims to widen the therapeutic window beyond GLP‑1 alone. (Frontiers)

Why glucagon with GLP‑1? GLP‑1 slows gastric emptying, enhances insulin secretion, and reduces appetite; glucagon increases hepatic lipid oxidation and raises energy expenditure—effects shown in human studies with oxyntomodulin. The co‑agonist strategy seeks greater fat‑mass reduction without proportionally increasing GLP‑1‑related GI intolerance. (Nature)

How is Mazdutide built? Mazdutide is an oxyntomodulin‑analog peptide with fatty‑acid acylation to extend half‑life via albumin binding—similar to long‑acting incretins—enabling once‑weekly administration. Specific sequence and modification positions have not been fully disclosed publicly, but authoritative reviews describe this general architecture. (MDPI)

Key clinical outcomes (high‑level):

  • Phase 2 RCT (24 weeks, 3–6 mg): Mazdutide produced dose‑dependent weight loss (LS mean −6.7%, −10.4%, −11.3% at 3, 4.5, 6 mg) versus +1.0% with placebo, with improvements in blood pressure, lipids, glycemic measures, ALT, and uric acid. (Nature)
  • Phase 1b MAD (9–10 mg): With a step‑up regimen (e.g., 3→6→9 mg over 12 weeks), weight fell −11.7% at week 12 (9 mg); a 16‑week 10 mg cohort also showed significant loss.
  • Phase 3 (NEJM, 32 weeks): 4 or 6 mg once weekly achieved clinically relevant weight reductions in Chinese adults with overweight/obesity. (Additional national approvals in China followed in 2025 for weight management and glycemic control.)

Safety signals to understand: Across trials, the most frequent adverse events were gastrointestinal (nausea, diarrhea, vomiting), generally mild to moderate; class‑typical increases in heart rate have been observed with GLP‑1/GCGR co‑agonists and reported with mazdutide (often transient; clinical significance under study). (Nature)

Evidence, Outcomes & What They Mean for Therapeutic Goals (educational)

Phase 2 randomized trial (Nature Communications, 2023). In a 24‑week, multi‑center RCT of Chinese adults with overweight or obesity, once‑weekly mazdutide produced dose‑dependent weight loss vs placebo: −6.7% (3 mg), −10.4% (4.5 mg), −11.3% (6 mg). Investigators also reported favorable shifts in glycemic variables (HbA1c, FPG, HOMA‑IR), blood pressure, lipids, and liver enzymes/uric acid. DEXA substudy data suggested proportionally greater fat mass than lean mass reduction. (Nature)

High‑dose explorations (eClinicalMedicine, 2022). A 9 mg 12‑week cohort using 3→6→9 mg titration achieved −11.7% mean weight change; a 10 mg 16‑week step‑up (2.5→5→7.5→10 mg) also showed significant loss. Adverse events were mostly mild/moderate GI or upper‑respiratory; no serious events were reported in these small cohorts.

Phase 3 (NEJM, 2025). Once‑weekly 4 mg or 6 mg for 32 weeks led to clinically meaningful weight reductions in adults with overweight/obesity (GLORY‑1 program). These data support the once‑weekly paradigm and informed China’s regulatory approvals for chronic weight management (June 2025) and type 2 diabetes glycemic control (September 2025).

Why outcomes may differ from GLP‑1 alone: Human and mechanistic data indicate glucagon co‑agonism can add energy‑expenditure benefits to GLP‑1’s appetite/glycemic effects—mirroring oxyntomodulin physiology, which increased total energy expenditure ~9% in a classic RCT. This helps explain robust fat‑mass reductions at relatively moderate GLP‑1 exposure. (Nature)

Information‑gain insight: A practical way to think about co‑agonists is the “Balance‑and‑Ramp” model:

  • Balance the GLP‑1:GCGR activity ratio to suppress appetite without excessive hyperglycemic drive from glucagon.
  • Ramp the dose deliberately to condition tolerability (GI) while tapping energy‑expenditure gains—mirroring the step‑ups used in trials (see below). (Frontiers)

Step‑by‑Step / How‑To (for research planning)

How should a researcher plan a mazdutide study? Define endpoints first (weight change, body composition, glycemia, BP/lipids, liver fat by MRI‑PDFF), then mirror trial‑proven titration where appropriate, and embed tolerability monitoring to protect data quality.

Step 1 — Specify the research question and endpoints

State the primary endpoint (e.g., % weight change at 12–24–32 weeks). Select secondary endpoints aligned to disease biology: fasting glucose/HbA1c, BP/lipids, ALT/AST, serum uric acid, and MRI‑PDFF if steatosis is of interest. These reflect the endpoints improved in RCTs. (Nature)

Step 2 — Choose study population and randomization

Match inclusion criteria to published trials (BMI thresholds, comorbidities), randomize against placebo or active comparator (e.g., semaglutide). Pre‑specify handling of anti‑drug antibodies (detected in a minority of subjects) and data imputation strategies. (Nature)

Step 3 — Model your dosing/titration on peer‑reviewed protocols

Examples drawn from trials:

  • 3 mg arm: 1.5 mg weeks 1–4 → 3 mg weeks 5–24.
  • 4.5 mg arm: 1.5 mg weeks 1–4 → 3 mg weeks 5–8 → 4.5 mg weeks 9–24.
  • 6 mg arm: 2 mg weeks 1–4 → 4 mg weeks 5–8 → 6 mg weeks 9–24.
  • 9 mg exploratory: 3→6→9 mg (12 weeks total).
  • 10 mg exploratory: 2.5→5→7.5→10 mg (16 weeks total).
    These step‑ups are educational exemplars derived from RCTs; align any new protocol to your IACUC/IRB and supplier documentation. (Nature)

Step 4 — Predefine AE surveillance and mitigation

Track GI symptoms (nausea, diarrhea, vomiting), heart rate, and injection‑site reactions at each visit. Build a dose‑pause/reduce rubric for moderate GI events and document cardiovascular signals given class effects on HR. (Nature)

Step 5 — Powering, statistics, and data integrity

Use historically observed placebo‑adjusted differences to power your primary endpoint (e.g., 8–12 percentage‑point placebo‑adjusted weight change over ~24 weeks in phase 2). Implement ANCOVA/MMRM as used in trials; prespecify sensitivity analyses and handling of COVID‑like disruptions if relevant. (Nature)

Step 6 — Resourcing: protocols & research material

For vial‑based protocol examples, see PeptideDosages.com’s educational pages for mazdutide 5 mg protocol and mazdutide 10 mg protocol (educational use only). For research‑grade material, PureLabPeptides provides 5 mg and 10 mg vials (for research use only).

Compliance note: This article is educational, not medical advice. Any in‑human use requires physician oversight and approved labeling; the purchase links are for research use only.

Comparison / Alternatives: Mazdutide vs Semaglutide vs Tirzepatide

Bottom line: Mazdutide adds energy‑expenditure via glucagon agonism (beyond appetite and glycemia), whereas semaglutide (GLP‑1) and tirzepatide (GLP‑1/GIP) rely primarily on intake reduction (and GIP‑dependent mechanisms). Clinical effect sizes depend on dose, duration, and population.

Molecule Mechanism Dosing (typical) Body‑weight change (trial & duration) Notes
Mazdutide Dual GLP‑1/GCGR (oxyntomodulin‑analog) Once weekly −11.3% (6 mg, 24 wk) vs +1.0% placebo (phase 2 RCT); phase 3 (32 wk) shows clinically relevant reductions at 4–6 mg Improves BP, lipids, glycemic markers; GI AEs common; HR increase reported across class; ongoing liver‑fat investigations. (Nature)
Semaglutide (2.4 mg) GLP‑1 RA Once weekly −14.9% (68 wk) vs −2.4% placebo (STEP‑1, NEJM) Strong weight loss and CV benefits; GI AEs typical of GLP‑1s.
Tirzepatide (5–15 mg) GLP‑1/GIP dual (“twincretin”) Once weekly Up to ~21% at 72 wk (SURMOUNT‑1, NEJM) Higher mean weight loss at top dose; GI AEs; distinct GIP biology.

Interpretation for outcomes: If maximal weight loss is the priority, tirzepatide currently holds the strongest mean reduction at 72 weeks; if a balanced metabolic profile with potential energy‑expenditure and hepatic benefits is the aim, mazdutide is a compelling co‑agonist to study further. Semaglutide remains a robust GLP‑1 benchmark.

Templates / Checklist / Example

Researcher’s Pre‑Study Checklist for Mazdutide (copy‑ready)

  • Define a single primary endpoint (e.g., % weight change at week 24 or 32).
  • Pre‑register analysis plan (ANCOVA/MMRM; handling of missing data).
  • Stratify randomization (e.g., BMI bands, sex) to balance metabolic risk.
  • Mirror published titration (e.g., 2→4→6 mg) and document pauses/reductions.
  • Track GI AEs, vitals (including heart rate), and laboratory panels each visit.
  • Add MRI‑PDFF if hepatic outcomes matter; standardize scanner & readers.
  • Schedule DEXA or alternative body‑composition at baseline and outcome visit.
  • Collect patient‑reported outcomes (e.g., IWQoL‑Lite), where relevant.
  • Train staff on injection technique and blinded AE adjudication.
  • Audit data entry weekly; run real‑time queries for outliers/missed visits. (Nature)

FAQs (NLP‑friendly, answer‑first)

What is mazdutide? Mazdutide is a once‑weekly dual GLP‑1/glucagon receptor agonist modeled on oxyntomodulin, designed to reduce appetite and increase energy expenditure; it has shown clinically meaningful weight loss and metabolic benefits in randomized trials. (Nature)

How does mazdutide work? Mazdutide co‑activates GLP‑1 and glucagon receptors, combining GLP‑1–driven appetite/glycemic effects with glucagon‑driven thermogenic/lipid‑oxidation effects seen with oxyntomodulin, thereby enhancing fat‑mass reduction. (PMC)

What results have clinical trials reported? Trials report dose‑dependent weight loss (e.g., −11.3% at 6 mg over 24 weeks vs +1% placebo) with favorable changes in BP, lipids, and glycemic indices; phase 3 (32 weeks) confirmed clinically relevant reductions at 4–6 mg. (Nature)

Is mazdutide approved anywhere? Yes—China approved mazdutide in 2025 for chronic weight management and glycemic control in adults with type 2 diabetes. Global development is ongoing.

How does mazdutide compare to semaglutide or tirzepatide? Semaglutide (GLP‑1) achieved −14.9% at 68 weeks; tirzepatide (GLP‑1/GIP) achieved ~20% at 72 weeks; mazdutide (GLP‑1/GCGR) showed double‑digit losses at 24–32 weeks with broader metabolic effects tied to glucagon biology. Mechanistic differences drive these profiles.

What adverse events are most common? GI events (nausea, diarrhea, vomiting) are most frequent and typically mild/moderate; small increases in heart rate are reported with GLP‑1/GCGR co‑agonists and observed with mazdutide, warranting monitoring. (Nature)

Next Steps

If you’re evaluating mazdutide in a research setting, ground your protocol in peer‑reviewed titration schedules, predefine hepatic and metabolic endpoints, and monitor GI and cardiovascular signals closely. For educational protocol examples, see PeptideDosages.com’s 5 mg and 10 mg pages. Research‑grade mazdutide is available via PureLabPeptides (5 mg, 10 mg). All products are for research use only.

Key takeaway: Mazdutide is a mechanistically distinct co‑agonist that pairs GLP‑1 appetite control with glucagon‑linked energy‑expenditure, yielding clinically meaningful weight loss and multi‑system metabolic benefits in trials. (Nature)

Livagen is a short “bioregulatory” peptide (sequence: Lys–Glu–Asp–Ala; alias KEDA) studied for its ability to loosen age‑condensed chromatin and normalize gene activity in older cells. In human lymphocyte experiments, Livagen de‑heterochromatinized DNA and reactivated ribosomal genes; in other models it modulated digestive enzymes and protected endogenous enkephalins by inhibiting their breakdown—without binding opioid receptors. Livagen is an experimental research compound, not an approved drug. (PubMed)

Fast Answer / Executive Summary (40–60 words)

Livagen is a tetrapeptide bioregulator (KEDA: Lys–Glu–Asp–Ala) investigated for epigenetic effects—specifically, opening compacted chromatin to restore youthful gene expression in aging cells. Studies in human lymphocytes and animal models report chromatin decondensation, improved protein synthesis rhythms, hepatoprotective and immunomodulatory effects, and potent inhibition of enkephalin‑degrading enzymes (without receptor agonism). Research use only; not medical advice. (PubMed)

Entity Properties (Research/Educational)
(Standardize names early: “Livagen,” sometimes misspelled “Lyvagen,” is the KEDA tetrapeptide; we use “Livagen (KEDA)” throughout.)

Property Value
Aliases / Synonyms Livagen; KEDA tetrapeptide; “liver peptide bioregulator”
Family / Pathway Ultrashort peptide bioregulator; epigenetic remodeling (chromatin de‑heterochromatinization); enzyme modulation (e.g., enkephalinase)
Sequence (AA) Lys–Glu–Asp–Ala (K–E–D–A)
Molecular Formula / Weight C18H31N5O9; ~461.5 Da (PubChem CID 87919683 for H‑Lys‑Glu‑Asp‑Ala‑OH)
CAS (if applicable) No validated CAS on PubChem for KEDA. Do not use 195875‑84‑4—that CAS belongs to tesofensine, not Livagen.
Typical Diluent(s) Bacteriostatic water (0.9% benzyl alcohol) or sterile saline (research handling)
Example Concentrations (educational) 20 mg vial + 2 mL diluent → 10 mg/mL; a 5 mg research dose volume would be 0.5 mL (50 “units” on a U‑100 insulin syringe).
Storage Lyophilized: frozen, protected from light (≤ –20 °C preferred). After reconstitution: aliquot, refrigerate short‑term; minimize freeze–thaw; solutions are less stable than powders.

Chemical identity per PubChem; note the widespread misattribution of CAS 195875‑84‑4 to Livagen—PubChem assigns that CAS to tesofensine. (PubChem)
Stability guidance summarized from peer‑reviewed pharmaceutical reviews on peptide/protein lyophilization and solution stability. (PMC)

Core Concepts & Key Entities

What is Livagen, and how is it studied? Livagen (KEDA) is an ultrashort tetrapeptide derived from peptide‑bioregulator research in gerontology. In cultured lymphocytes from older adults, Livagen activated ribosomal genes and decondensed age‑tightened chromatin, a hallmark mechanism proposed to restore more youthful transcriptional activity. (PubMed)

How does Livagen relate to epigenetics and outcomes? The peptide’s defining action is remodeling heterochromatin—reversing age‑related chromatin compaction (de‑heterochromatinization) that represses transcription. Independent teams report selective remodeling of constitutional and facultative heterochromatin in elders’ lymphocytes with Livagen and related peptides, reinforcing a mechanistic link between chromatin structure and functional rejuvenation. (PubMed)

Which adjacent entities matter? In the bioregulator family, Epitalon (AEDG), Vilon (KE), and Thymalin frequently appear alongside Livagen. Epitalon activates telomerase and extended telomeres in human cell studies; Vilon and Thymalin exhibit immune‑modulatory effects in preclinical and clinical contexts. Positioning Livagen among these clarifies overlap (immune and gene‑regulatory effects) and differences (e.g., telomeres vs. chromatin focus). (PubMed)

Key mechanisms tied to outcomes (evidence‑first):

  • Chromatin opening & gene reactivation: In human lymphocytes from older donors, Livagen activated ribosomal genes and relaxed pericentromeric heterochromatin—changes consistent with restoring protein‑synthetic capacity. (PubMed)
  • Protein synthesis rhythms in aging liver cells: In rat hepatocyte cultures, Livagen increased the amplitude of protein‑synthesis oscillations in old animals’, suggesting a partial “youthful” reset of hepatic protein metabolism. (PubMed)
  • Digestive enzyme modulation & oral stability signal: Rat studies found Livagen weakly hydrolyzed by intestinal peptidases and able to normalize GI enzyme activity in opposite directions by age (down in young, up in old). (PubMed)
  • Endogenous opioid system support (without receptor agonism): Livagen inhibited enkephalin‑degrading enzymes with an IC50 ≈ 20 µM (vs. ≈ 500 µM for Epitalon) and did not bind μ/δ opioid receptors—consistent with preserving natural analgesic peptides rather than acting as an opioid. (PubMed)
  • Hepatoprotective & immunomodulatory signals: In animal models of hepatitis and liver fibrosis, the liver tetrapeptide KEDA (Livagen) normalized immune/antioxidant status and liver function, with strongest effects in aged cohorts. (PubMed)
  • Genome‑stabilizing context in vascular disease: Chromatin‑modifying bioregulators including Livagen improved genomic instability markers in patients with atherosclerosis, hinting at broader cardiometabolic relevance. (PubMed)
  • Peptide transport & delivery considerations: Reviews of ultrashort peptide transport highlight uptake via peptide transporters (e.g., POT/LAT families) and relative stability of some tetrapeptides in GI and tissue homogenates—mechanistic context for observed bioactivity patterns in preclinical work. (PMC)

Bottom line: Livagen’s most distinctive contribution is epigenetic—“opening” parts of aging chromatin so key genes resume work, which in turn links to immune, hepatic, and neuropeptide outcomes reported in preclinical studies. It remains investigational and is not an approved therapy. (PubMed)

Step‑by‑Step / How‑To (Educational; Research Handling Only)

How do researchers typically handle Livagen? Researchers generally reconstitute lyophilized Livagen with sterile diluent, calculate target concentrations, administer per study design, and store aliquots to preserve integrity. Below is a practical, copy‑ready framework for lab use (not medical guidance).

1) Confirm identity & plan your concentration

Verify sequence (KEDA), formula (C18H31N5O9), and purity from supplier documentation. For easy math, many labs target 10 mg/mL (e.g., 20 mg + 2 mL). Record batch, lot, and date for traceability. (Identity per PubChem.) (PubChem)

2) Reconstitute gently

Using sterile technique, inject bacteriostatic water down the vial wall; swirl—don’t shake—until dissolved. Avoid foaming. If the study requires higher concentration (e.g., 20 mg/mL), reduce diluent proportionally and annotate all calculations.

3) Dose calculation & measurement

At 10 mg/mL, 1 mL contains 10 mg. Example: 5 mg target → 0.5 mL. For small volumes, U‑100 insulin syringes (in research) read “units” where 50 units ≈ 0.5 mL. Double‑check math and labels; have a second person verify critical steps.

4) Administration modality (study‑dependent)

Preclinical protocols often use subcutaneous or intraperitoneal routes; in vitro work applies defined media concentrations. Choose route/vehicle per study aims, species, and ethics approvals. (No human treatment claims; this is investigational use only.)

5) Storage & stability best practices

Lyophilized: store frozen, protected from light; solutions degrade faster—aliquot and keep cold; minimize freeze–thaw. Reviews in pharmaceutical science consistently show powders are more stable than solutions and advocate cold, dry storage for longevity. (PMC)

Comparison / Alternatives (“Livagen vs. other bioregulators”)

How does Livagen compare to Epitalon, Thymalin, and Vilon? Livagen emphasizes chromatin remodeling in immune/hepatic contexts; Epitalon emphasizes telomerase/telomeres; Thymalin and Vilon emphasize immune regulation. This table pinpoints outcome‑relevant differences using peer‑reviewed signals:

Feature Livagen (KEDA) Epitalon (AEDG) Thymalin (thymic complex) Vilon (KE)
Primary mechanism Chromatin de‑heterochromatinization; ribosomal gene activation; enzyme modulation Telomerase activation & telomere elongation in human somatic cells Thymic‑derived immune regulation; clinical use reports in immunopathologies Chromatin effects; immune‑modulation in models
Signature evidence Human lymphocyte studies show decondensed heterochromatin & rDNA activation; rat work shows protein‑synthesis rhythm improvement in aged hepatocytes Human cell work shows telomerase induction & telomere elongation Reviews and clinical experience summarize immune status normalization in older/immunocompromised groups Studies report reactivation of chromatin in lymphocytes from older adults
Neuropeptide angle Potently inhibits enkephalin‑degrading enzymes; no μ/δ receptor binding Inhibits enkephalinases far less potently than Livagen Not a focus Not a focus
Where it “leans” Epigenetic cellular renewal; immune/liver outcomes Genomic stability; circadian/endocrine context Immune resilience; clinical adjunct contexts Immune/epigenetic
Representative sources Khavinson 2002; Timofeeva 2005; Brodskii 2001; Kost 2003 Khavinson 2003 (Bull Exp Biol Med) Kuznik 2021 (review/overview) Lezhava 2006; Khavinson 2004

Citations: Livagen chromatin/protein: (PubMed); Epitalon telomerase: (PubMed); Thymalin immune: (PMC); Vilon chromatin: (PubMed); Livagen enkephalinase: (PubMed)

Templates / Checklist / Example

Copy‑ready checklist: Responsible Livagen Research Use

  • Verify identity: Confirm sequence (KEDA), purity, and lot; archive COA and supplier details. (PubChem)
  • Standardize naming: Use “Livagen (KEDA: Lys–Glu–Asp–Ala)” and avoid mis‑CAS (195875‑84‑4 = tesofensine) in your records. (PubChem)
  • Define aim & endpoints: Pre‑specify hypotheses (e.g., chromatin markers, enzyme assays, immune readouts). Align sampling with mechanism. (PubMed)
  • Choose route & model: Match route (e.g., SC/IP; in vitro media dosing) to the question; comply with IACUC/IRB as applicable.
  • Calculate concentrations: Plan an easy concentration (e.g., 10 mg/mL) and prepare a dosing sheet to prevent arithmetic errors.
  • Reconstitute cleanly: Swirl, don’t shake; label with concentration/date; document any pH/vehicle adjustments.
  • Aliquot & store: Aliquot to minimize freeze–thaw; powders at ≤ –20 °C; solutions cold, brief storage; document excursions. (PMC)
  • Monitor effects: Track predefined markers: chromatin assays (NOR, C‑bands), enzyme activity, or cytokines (depending on model). (PubMed)
  • Note safety signals: Record injection‑site reactions (animal work), behavior changes, or unexpected lab deviations.
  • Report transparently: Disclose that Livagen is investigational; provide exact lot/concentration/protocol details for reproducibility.

FAQs (NLP‑friendly, answer‑first)

1) What is Livagen?
Livagen is a tetrapeptide bioregulator (KEDA: Lys–Glu–Asp–Ala) studied for epigenetic effects in aging cells. In human lymphocyte models, it de‑heterochromatinized compacted DNA and reactivated ribosomal genes; in rat studies, it modulated digestive enzymes and improved protein‑synthesis rhythms in aged hepatocytes. (PubMed)

2) How does Livagen work?
Livagen works by remodeling chromatin—opening age‑compacted regions so key genes can be transcribed again. This underpins reported changes in rDNA activity, heterochromatin structure, and enzyme regulation. Its enzyme‑inhibition of enkephalinases may elevate natural analgesic peptides without opioid receptor binding. (PubMed)

3) Is there clinical evidence for Livagen?
Clinical‑grade trials for Livagen are limited; most evidence is preclinical or ex vivo. Related bioregulators (e.g., Thymalin) have broader clinical literature on immune modulation, while Epitalon shows human‑cell telomerase effects. Livagen itself has human cell studies and animal data supporting epigenetic and hepatic/immune endpoints. (PMC)

4) Does Livagen affect pain or mood?
Livagen affects the endogenous opioid system by inhibiting enkephalin‑degrading enzymes (IC50 ≈ 20 µM) in vitro, which can preserve natural enkephalins; crucially, it does not bind μ/δ opioid receptors in rat brain membranes. Translational significance remains to be established in controlled trials. (PubMed)

5) Is Livagen orally active?
Livagen appears unusually resistant to intestinal hydrolysis in rats, where small‑intestine peptidases did not significantly degrade it; age‑dependent enzyme normalization was observed after oral administration in animal models. Human oral bioavailability hasn’t been established. (PubMed)

6) How should Livagen be stored for research?
Store Livagen lyophilized at cold temperatures and protect from light; after reconstitution, aliquot and keep cold, minimizing freeze–thaw. Pharmaceutical reviews consistently show peptides are far more stable as dry powders than in solution. (PMC)

Next Steps

If you’re exploring Livagen as a research tool, anchor your protocol to its core mechanism (chromatin remodeling) and pick measurable endpoints accordingly. For a step‑by‑step setup, see our internal guide to practical calculations in the Livagen 20 mg dosage protocol (educational only). (peptidedosages.com)

When sourcing for laboratory work, use reputable suppliers that provide COAs and consistency across lots; one option for research‑use material is PureLabPeptides’s Livagen (20 mg) listing. (Research use only; no medical claims).

Key takeaway: Livagen’s value proposition is epigenetic—selectively “opening” aging chromatin to restore gene activity, with preclinical signals across immune, hepatic, and neuropeptide pathways—but rigorous clinical validation is still ahead. (PubMed)

Peptide enthusiasts often ask “What is Selank and why do researchers use it for anxiety and cognition?” In short: Selank is a tuftsin‑derived heptapeptide explored for anxiolytic and nootropic effects without sedation. Below you’ll find an answer‑first overview of how it works, research-use handling, comparisons (Semax/benzodiazepines), and FAQs—written for education, not medical advice.

Fast Answer / Executive Summary (40–60 words)

Selank is a synthetic tuftsin‑analog heptapeptide (sequence TKPRPGP) studied for reducing anxiety and sharpening cognition while sparing alertness. Mechanistically, studies show modulation of GABA‑related gene expression, monoamines/serotonin, BDNF, enkephalin preservation, and immune cytokines (e.g., IL‑6)—a multi‑system profile that explains its calm‑yet‑clear outcomes in clinical and preclinical models. (PMC)

Entity Properties (for researchers)

Normalization note: You may see “Selanc” or “TP‑7” used; the standardized name here is Selank.

Property Details
Aliases / Synonyms Selanc; TP‑7; UNII: TS9JR8EP1G. (GSRS)
Family / Pathway Tuftsin analog (immunomodulatory peptide family) with glyproline (PGP) motif aiding stability. (Most Wiedzy)
Sequence (AA) Thr–Lys–Pro–Arg–Pro–Gly–Pro (TKPRPGP). (PubChem)
Molecular Weight (Da) ~751.9 g/mol. (PubChem)
CAS 129954‑34‑3. (PubChem)
Typical Diluent(s) Sterile water for injection (often bacteriostatic water 0.9% benzyl alcohol) or 0.9% saline (research use). Use promptly unless manufacturer of the solute specifies otherwise. (DailyMed)
Example Concentrations (educational) 5 mg vial + 2 mL diluent → 2.5 mg/mL (2,500 µg/mL). 0.10 mL ≈ 250 µg. (Calculation example only.)
Storage Lyophilized peptides are typically kept refrigerated or frozen; reconstituted solutions should be kept 2–8 °C, minimize freeze–thaw, and used relatively soon, per stability best practices for peptides. (PMC)

Core Concepts & Key Entities

What is Selank and why is it studied?

Selank is a seven–amino‑acid analog of the immune peptide tuftsin engineered to provide anxiolysis without sedative trade‑offs. In a head‑to‑head clinical study in patients with generalized anxiety disorder (GAD) and neurasthenia, Selank’s anxiolytic effect matched medazepam (a benzodiazepine) while adding antiasthenic/psychostimulant benefits. (PubMed)

How does Selank modulate neurotransmission?

Selank influences GABA‑related and monoaminergic signaling in ways that reduce anxiety while preserving cognition. Transcriptomic work shows broad regulation of GABAergic genes after Selank administration; researchers interpret this as indirect GABAergic modulation (not classic benzodiazepine receptor agonism). (PMC)
In parallel, BDNF—a key neuroplasticity factor—rises in hippocampus after intranasal Selank in vivo, supporting pro‑cognitive effects. (PubMed)

Enkephalin preservation: a unique lever

Selank inhibits human serum enkephalin‑degrading enzymes (enkephalinases), prolonging endogenous enkephalin tone linked to stress relief and analgesia. Reported IC₅₀ values are ~20 µM (Selank), stronger than bacitracin/puromycin comparators in the same assay. This mechanism complements its anxiolytic phenotype. (PubMed)

Immune–brain crosstalk (IL‑6 and cytokine balance)

As a tuftsin analog, Selank shows immunomodulatory effects—notably altered expression of cytokine/chemokine genes (≈34 targets in mouse spleen) and normalization of inflammatory signals under stress. This may explain reports of improved stress resilience. (PubMed)

Antiviral signal: an information‑gain angle

Beyond anxiety, Selank demonstrated antiviral activity against influenza A/H3N2 in vitro and in vivo with strongest effect via preventive pre‑exposure administration, hinting at innate‑immunity priming. While not an antiviral drug, this result strengthens the “stress‑immune” narrative. (PubMed)

Why “calm without sedation” matters

Across clinical and translational work, Selank reduces anxiety without typical benzodiazepine downsides (amnesia, withdrawal). This has been explicitly noted in mechanistic and gene‑expression studies tied to GABA modulation, and in patient‑level data showing preserved—or improved—mental energy. (PMC)

Step‑by‑Step / How‑To (Research Use Only)

Educational only—no medical advice. The steps below outline laboratory‑style handling common in peptide research.

1) Plan your target concentration

Decide on a working solution that makes microgram‑level measurements easy. Example: 5 mg vial + 2 mL diluent → 2.5 mg/mL; 0.10 mL = 250 µg. For higher precision at smaller volumes, consider 5 mg + 4 mL → 1.25 mg/mL (0.10 mL = 125 µg).

2) Reconstitute with sterile technique

Use sterile water for injection (often bacteriostatic water) or 0.9% saline. Clean the stopper with alcohol; direct the diluent along the vial wall; swirl gently to dissolve. (DailyMed cautions to mix thoroughly and use promptly unless the solute’s manufacturer specifies otherwise.) (DailyMed)

3) Select an administration route (research contexts)

  • Subcutaneous (SC): common in research for reliable bioavailability.
  • Intranasal (IN): supported by mechanistic data (hippocampal BDNF upregulation after IN dosing), and widely used in Russian clinical practice. (PubMed)

4) Educational dosing ranges (by literature context)

Human clinical and translational literature frequently explores hundreds of micrograms per day, with some Russian protocols using multiple daily IN administrations; onset can be rapid in some patients (days). Researchers adjust by symptoms and tolerability in protocolized settings. (Cambridge University Press & Assessment)

5) Document outcomes and adjust

Track standardized anxiety/cognition scales (e.g., HAM‑A, Zung) akin to published trials, along with time‑of‑day and route, to understand response patterns and potential day‑to‑day variability. (PubMed)

6) Store to maintain integrity

Keep lyophilized material refrigerated/frozen; keep reconstituted material 2–8 °C, avoid repeated freeze–thaw, and minimize storage time consistent with peptide‑stability best practices; when in doubt, prepare fresh aliquots. (PMC)

Comparison / Alternatives

What makes Selank different? Selank vs. Semax vs. benzodiazepines boils down to calm‑focus vs. active‑focus vs. sedative‑anxiolysis. The table below summarizes.

Dimension Selank Semax Benzodiazepines (e.g., diazepam/medazepam)
What it is Tuftsin‑analog heptapeptide (TKPRPGP). (PubChem) ACTH(4‑10)‑analog heptapeptide (MEHFPGP). (PubMed) Small‑molecule GABA_A positive allosteric modulators.
Primary outcome Anxiolysis without sedation, with pro‑cognitive signal. (PubMed) Cognitive enhancement / neuroprotection (BDNF‑centric). (PubMed) Anxiolysis with sedation; risks of amnesia, tolerance, withdrawal.
Key mechanisms GABA‑related gene modulation; ↑BDNF (hippocampus); enkephalinase inhibition; immune cytokine balancing (e.g., IL‑6). (PMC) ↑BDNF/TrkB signaling; dopaminergic/serotonergic effects; clinical use post‑stroke in Russia. (PubMed) Directly boost GABA_A receptor activity (broad CNS depression).
Clinical signals Comparable anxiolysis to medazepam, added anti‑asthenic/psychostimulant effects; rapid responders reported in GAD cohorts. (PubMed) BDNF increases and functional gains in stroke rehabilitation cohorts. (PubMed) Effective for acute anxiety; cognitive/psychomotor impairment common.
Cognition Often preserved or improved as anxiety falls. (PMC) Enhanced attention/memory; potential stimulation. (PubMed) Impaired memory/attention at therapeutic doses.
Tolerance / dependence Not associated with benzodiazepine‑type dependence in literature to date. (PMC) Not associated with benzo‑type dependence. Tolerance/dependence risks with chronic use are well‑described.
Notable extra Antiviral/immune signals in models; cytokine gene normalization. (PubMed) Neuroprotection under ischemia; rehabilitative settings. (PubMed) N/A

Bottom line: Selank is best when anxiety + cognitive clarity are dual aims; Semax when pure cognition/neuroprotection is paramount; benzodiazepines remain potent but sedating and potentially habit‑forming.

Templates / Checklist / Example

Copy‑ready Researcher Checklist (Selank)

  • Define objective: State the outcome of interest (e.g., acute anxiolysis vs. sustained cognitive clarity).
  • Standardize naming: Record “Selank (TKPRPGP; CAS 129954‑34‑3)” to avoid confusion with “Selanc/TP‑7.” (PubChem)
  • Select route: SC for bioavailability; IN if modeling translational use supported by hippocampal BDNF data. (PubMed)
  • Set concentration: Choose mL to make µg math easy (e.g., 5 mg → 2 mL → 2.5 mg/mL).
  • Practice asepsis: Alcohol swab stoppers/skin, sterile needle/syringe, avoid touching sterile parts; mix gently. (DailyMed)
  • Start low, titrate: Begin in the lower hundreds of µg per day if modeling human‑adjacent paradigms; adjust per outcome scales. (PubMed)
  • Record with scales: Log HAM‑A, Zung, or similar at baseline and intervals. (PubMed)
  • Avoid long warm storage: Keep reconstituted aliquots 2–8 °C, minimize freeze–thaw; prepare fresh as needed. (PMC)
  • Note immune endpoints: If studying stress‑immune crosstalk, include cytokine panels (e.g., IL‑6) pre/post. (PubMed)
  • Plan a washout: Build in off‑periods to observe persistence and reversibility of effects.

FAQs (Answer‑first, PAA‑style)

1) What is Selank?
Selank is a synthetic heptapeptide (TKPRPGP) derived from tuftsin that’s studied for anxiolytic and cognitive effects without sedation. Core mechanisms include GABA‑related gene modulation, BDNF increases, enkephalinase inhibition, and cytokine balancing, explaining calm‑yet‑clear outcomes observed across models and clinical cohorts. (PMC)

2) How fast can Selank work?
Selank can act quickly in some patients: clinical observations in GAD cohorts report rapid responders within days, and mechanistically, intranasal dosing alters hippocampal BDNF expression in vivo, a plausible substrate for earlier cognitive/affective change. (Cambridge University Press & Assessment)

3) Does Selank cause sedation like benzodiazepines?
Selank is non‑sedating in the literature and has even shown antiasthenic/psychostimulant signals, contrasting with benzodiazepines’ cognitive/psychomotor impairment. In a comparative clinical study, Selank matched medazepam’s anxiolysis without sedative downsides. (PubMed)

4) What’s unique about Selank’s mechanism vs. other nootropics?
Selank uniquely combines neurochemical (GABA/monoamines/BDNF) and immunomodulatory actions and inhibits enkephalinases, prolonging endogenous anti‑stress peptides—an uncommon multi‑axis profile among nootropics. (PMC)

5) Is Selank approved anywhere?
Selank is used clinically in Russia (including GAD contexts), with abstracts and conference proceedings noting status and rapid‑ vs slow‑response phenotypes. Outside Russia, it’s primarily a research compound. (Cambridge University Press & Assessment)

6) Where can researchers source Selank and find dosing math?
Researchers typically procure Selank as lyophilized powder (5 mg or 10 mg vials), then reconstitute and calculate microgram‑level aliquots. For purchase as research‑grade material, see Selank 5 mg or Selank 10 mg (COA‑driven supply). For step‑by‑step dilution math, see PeptideDosages guides linked below. (Educational; not medical advice.)

Next Steps

Key takeaway: Selank’s value is its rare combination of anxiolysis without sedation plus cognitive support, underpinned by GABA/BDNF/enkephalin/immune mechanisms—making it a compelling peptide to study when calm clarity is the goal. (PubMed)

Ipamorelin (sometimes listed as NNC 26‑0161) is a selective growth hormone secretagogue (GHS) that binds the ghrelin receptor (GHSR‑1a) to trigger pulsatile GH release with minimal impact on ACTH or cortisol in preclinical models. Below you’ll find a concise answer, a properties table, outcomes‑focused mechanisms, step‑by‑step research‑handling guidance, comparisons vs. similar agents, a checklist, and FAQs. (PubMed)

Fast Answer / Executive Summary (40–60 words)

Ipamorelin is a pentapeptide ghrelin‑receptor agonist that selectively stimulates pulsatile growth hormone (GH) release without measurably raising ACTH/cortisol in animal models, and produces a short‑acting GH pulse in humans (peak ≈ 40 minutes; peptide t½ ≈ 2 hours). Mechanistically, it amplifies GH output via GHSR‑1a, complementing the GHRH pathway. Educational use only. (PubMed)

Ipamorelin — Entity Properties (educational)

Property Detail
Aliases / Synonyms Ipamorelin; NNC 26‑0161; UNII: Y9M3S784Z6
Family / Pathway Ghrelin receptor (GHSR‑1a) agonist; growth hormone secretagogue (GHS)
Sequence (AA) Aib–His–D‑2‑Nal–D‑Phe–Lys–NH₂ (pentapeptide)
Molecular Weight (Da) ~711.9
CAS 170851‑70‑4
Typical Diluent(s) (educational) Bacteriostatic Water for Injection, USP (sterile water with 0.9–1.1% benzyl alcohol; multi‑dose). Use per lab SOPs.
Example Concentration(s) (educational) Reconstitute 5 mg vial with 2.0 mL → 2.5 mg/mL; 10 mg with 4.0 mL → 2.5 mg/mL (math example; not medical dosing).
Storage (lyophilized / after reconstitution) Lyophilized peptides often stored at ≤ −20 °C protected from light; solutions are less stable—short‑term 2–8 °C; for longer storage, freeze aliquots per SOPs to avoid freeze–thaw cycles.

Sources: chemical identity from PubChem/DrugBank; diluent identity from DailyMed (USP); general peptide stability practices from peer‑reviewed reviews on peptide stability. (PubChem)

Core Concepts & Key Entities

What is Ipamorelin, precisely? Ipamorelin is a selective GHS that activates GHSR‑1a (the ghrelin receptor) to induce GH release while sparing other pituitary axes (ACTH/cortisol) in animal models. Early pharmacology work benchmarked this selectivity against GHRP‑6 and GHRP‑2; only ipamorelin avoided ACTH/cortisol elevations even at very high doses in swine. (PubMed)

How does Ipamorelin generate a GH “pulse”? In healthy volunteers, short infusions produced a single GH episode peaking around 0.67 hours (~40 minutes) with a peptide terminal half‑life near 2 hours—consistent with a brief, physiologic‑like pulse that returns to baseline. This profile lends itself to outcome‑focused protocols that respect GH’s natural pulsatility. (PubMed)

Where does GHSR‑1a fit in GH physiology? GHSR‑1a is a GPCR expressed in pituitary somatotrophs and hypothalamic circuits. Endogenous ghrelin boosts GH by synergizing with GHRH and by counteracting somatostatin’s inhibitory tone—explaining why GHSs can augment rather than replace physiologic pulsatility. Ipamorelin leverages this same receptor system. (PMC)

Why “timing” matters for outcomes. In adults, 60–70% of daily GH secretion clusters after sleep onset with slow‑wave sleep, so researchers sometimes align short‑acting GHS administration with times that do not blunt natural nocturnal pulses (educational perspective). The goal in research designs is to support rather than flatten physiologic rhythms. (JAMA Network)

Selectivity vs. older GHRPs. Classic GHRPs (e.g., GHRP‑6, hexarelin) can raise ACTH, cortisol, and prolactin, especially with intravenous or high exposure, while ipamorelin showed minimal ACTH/cortisol effects in animal tests at doses >200× its GH ED50—an important distinction for interpreting endocrine “side‑signal” noise in experiments. (OUP Academic)

Information‑gain insight: Think of ipamorelin as a “precision tap” on the GH axis. Where GHRP‑6 acts like a broad faucet (GH + neuroendocrine spillover), ipamorelin behaves like a targeted lever: brief, focused GH pulses with less off‑target pituitary noise—a mechanistic nuance that often gets lost in simplified “all GHSs are the same” blog summaries. (PubMed)

Step‑by‑Step / How‑To (Educational; research handling)

Note: For research use only. Follow your institution’s SOPs, the product’s COA, and applicable regulations. The steps below are educational and not medical advice.

1) Verify identity & integrity

Confirm peptide name, lot, mass, and purity on the COA; inspect the lyophilized cake and vial seals. Cross‑check identifiers (CAS 170851‑70‑4, UNII Y9M3S784Z6). (PubChem)

2) Plan concentration math

Decide on an educational working concentration before opening the vial. Example: 5 mg + 2.0 mL → 2.5 mg/mL (or 10 mg + 4.0 mL → 2.5 mg/mL). Keep the math separate from any hypothetical dosing discussions.

3) Choose an appropriate diluent (per SOP)

For many injectable research formats, labs use Bacteriostatic Water for Injection, USP (sterile water plus 0.9–1.1% benzyl alcohol preservative) as a multi‑dose diluent. Validate compatibility with your application and SOP; do not use bacteriostatic diluents in neonates. (DailyMed)

4) Reconstitute with sterility and patience

Warm vial/diluent to room temperature; swab stoppers; inject diluent gently along the glass wall; swirl (avoid foaming). Do not shake vigorously—peptide solutions can aggregate under stress. (PMC)

5) Label clearly

Record compound, lot, concentration, diluent, date/time of reconstitution, and storage conditions. Maintain chain‑of‑custody and usage logs per QA.

6) Store to preserve integrity

General, educational guidance from peer‑reviewed peptide‑stability literature: lyophilized peptides are typically stable at ≤ −20 °C protected from light; solutions degrade faster—use 2–8 °C short‑term, and freeze aliquots (≤ −20/−80 °C) to limit freeze–thaw cycles when longer storage is required. Your SOP governs specifics. (PMC)

7) Dispose responsibly

Follow hazardous waste and bio‑safety procedures. Document disposal in your lab’s records.

Comparison / Alternatives (Ipamorelin vs. Common GHS/GHRH/GHS‑mimetics)

Bottom line: Ipamorelin is the most selective GH‑centric secretagogue among first‑generation GHRPs tested preclinically, producing brief, targeted GH pulses in humans. Longer‑acting options (e.g., CJC‑1295) change the timing of GH/IGF‑1 exposure, while oral MK‑677 (ibutamoren) increases 24‑h GH/IGF‑1 with appetite and mild metabolic effects reported. (PubMed)

Feature Ipamorelin GHRP‑6 / GHRP‑2 CJC‑1295 (DAC) MK‑677 (Ibutamoren)
Class / Target GHS; GHSR‑1a agonist GHS; GHSR‑1a agonists GHRH analogue (long‑acting) Oral GHS mimetic
GH Profile Short, pulse‑like GH burst; peak ≈ 0.67 h Pulsatile; often broader endocrine signal Sustained GH/IGF‑1 elevation days–weeks Elevated 24‑h GH/IGF‑1 over months
Selectivity (ACTH/cortisol) Minimal ACTH/cortisol in animal tests, even at high doses Often increases ACTH/cortisol & prolactin (esp. IV/high dose) GH‑centric (via GHRH receptor) Cortisol ↑ modestly; appetite ↑
Approx. Half‑life ~2 h (peptide t½) Short ~6–9 days (effective t½) Oral daily; long PD
Notable Considerations Targeted GH pulse; selective profile Appetite stimulation common; broader pituitary effects Long persistence—align with study aims ↑ FFM but also ↑ weight; glucose/insulin sensitivity shifts in older adults
Key Evidence Selectivity (animal); PK/PD in humans Endocrine spillover (ACTH/PRL) Human PK/PD and IGF‑1 dynamics 12‑month RCT in older adults

Sources: Ipamorelin selectivity and human PK/PD; GHRP endocrine effects; CJC‑1295 half‑life; MK‑677 effects. (PubMed)

Templates / Checklist / Example

Copy‑ready Research Checklist (educational)

  • Confirm compound identity (ipamorelin; CAS 170851‑70‑4; UNII Y9M3S784Z6) and inspect packaging. (PubChem)
  • Align study aims with GH pulsatility (short pulse vs. sustained exposure). (JAMA Network)
  • Select a diluent that matches SOPs (e.g., Bacteriostatic Water for Injection, USP, multi‑dose). (DailyMed)
  • Plan a target concentration (e.g., 5 mg in 2.0 mL → 2.5 mg/mL) and document calculations.
  • Reconstitute gently; avoid foaming/shaking; mix patiently to limit aggregation. (PMC)
  • Label vial with compound, lot, concentration, diluent, date/time, storage.
  • Store lyophilized at ≤ −20 °C (protected from light); use 2–8 °C short‑term for solutions; freeze aliquots to minimize freeze–thaw. (PMC)
  • Monitor any co‑measured endocrine endpoints (e.g., ACTH/cortisol) when comparing different GHSs. (OUP Academic)
  • Record usage, stability observations, and disposal per QA requirements.

FAQs (clear, answer‑first; educational)

1) What is Ipamorelin?
Ipamorelin is a selective growth hormone secretagogue that activates the ghrelin receptor (GHSR‑1a) to produce a brief, physiologic‑like GH pulse. It is a pentapeptide (Aib‑His‑D‑2‑Nal‑D‑Phe‑Lys‑NH₂) developed to maximize GH selectivity relative to older GHRPs. Educational use only. (PMC)

2) How long does Ipamorelin last?
Ipamorelin’s GH effect in humans peaks at ~0.67 hours (~40 minutes) with a peptide half‑life of ~2 hours, based on infusion PK/PD modeling. The GH rise is episodic and declines back to baseline thereafter. (PubMed)

3) Does Ipamorelin affect cortisol or prolactin like GHRP‑6?
Ipamorelin did not increase ACTH/cortisol above GHRH‑like levels in animal studies even at >200× its GH ED50, whereas GHRP‑6 and related agents can raise ACTH/cortisol and prolactin depending on exposure and route. (PubMed)

4) Can Ipamorelin be combined with a GHRH analogue (e.g., CJC‑1295) in research?
Ghrelin‑pathway agonism (GHSR‑1a) and GHRH signaling are mechanistically complementary, and literature describes synergy between ghrelin and GHRH on GH release; CJC‑1295 provides long‑lasting GHRH‑receptor stimulation. Research designs must weigh pulse timing vs. sustained exposure. (PMC)

5) What outcomes are associated with GHS exposure in human trials?
Outcomes depend on the agent and exposure pattern. For example, oral MK‑677 increased fat‑free mass and IGF‑1 in older adults but also increased appetite, body weight, fasting glucose, and cortisol modestly—useful context when comparing short‑pulse (ipamorelin) vs. chronic (oral) exposure designs. (PMC)

6) Is Ipamorelin permitted in sport?
No. Growth‑hormone‑releasing factors and secretagogues—including ipamorelin—are on the WADA Prohibited List at all times. Researchers working with athlete populations must refer to current antidoping rules. (Wada-Ama)

7) What risks should researchers monitor when studying GH modulation?
GH pathway modulation can relate to fluid retention, paresthesias, arthralgia, insulin sensitivity shifts, and lipid changes, particularly when exposure is sustained. These effects are documented in GH‑therapy literature and are relevant context when designing or interpreting GHS studies. (PMC)

Next Steps

If your goal is an educational, outcomes‑oriented overview with practical lab math and reconstitution details, bookmark PeptideDosages.com’s ipamorelin protocol pages:

When you’re ready to source research‑grade material from a supplier that emphasizes testing and quality controls, see:

Key takeaway: Ipamorelin is best understood as a short‑acting, GH‑selective “pulse tool” via GHSR‑1a—useful for research questions where timing and endocrine selectivity matter. Educational content only; no medical advice. (PubMed)